EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06560 - GPI)
FAM  PF06560
PID  GPI
DES  Glucose-6-phosphate isomerase (GPI)
IPR  IPR010551
ANO  6
ALN  190
AID  0.319286
APH  ((Q8ZMP7_SALTY/31-215:0.76506,(GPI_PYRHO/24-186:0.32647,(GPI1_RHIME/27-194:0.22728,GPI2_RHIME/27-194:0.43122):0.45588):0.87078):0.42814,O28778_ARCFU/14-189:0.49545,Q8PVJ5_METMA/16-196:0.43074);
ATP  ((Q8ZMP7_SALTY/31-215,(GPI_PYRHO/24-186,(GPI1_RHIME/27-194,GPI2_RHIME/27-194))),O28778_ARCFU/14-189,Q8PVJ5_METMA/16-196);
ATL  4.43102
DNO  5
DLN  570
DID  0.4378
DPH  ((Q8ZMP7_SALTY/31-215:0.53056,(O28778_ARCFU/14-189:0.35447,Q8PVJ5_METMA/16-196:0.36260):0.22665):0.49689,GPI1_RHIME/27-194:0.20622,GPI2_RHIME/27-194:0.38530);
DTP  ((Q8ZMP7_SALTY/31-215,(O28778_ARCFU/14-189,Q8PVJ5_METMA/16-196)),GPI1_RHIME/27-194,GPI2_RHIME/27-194);
DTL  2.56269
RID  0.312987
RPH  ((Q8ZMP7_SALTY/31-215:0.83884,(O28778_ARCFU/14-189:0.51841,Q8PVJ5_METMA/16-196:0.40684):0.37225):1.27884,GPI1_RHIME/27-194:0.12593,GPI2_RHIME/27-194:0.52863);
RTP  ((Q8ZMP7_SALTY/31-215,(O28778_ARCFU/14-189,Q8PVJ5_METMA/16-196)),GPI1_RHIME/27-194,GPI2_RHIME/27-194);
RTL  4.06975
LNK  GPI1_RHIME/27-194:Q92MQ8:AL591791
LNK  GPI2_RHIME/27-194:Q92UI1:AL591985
LNK  GPI_PYRHO/24-186:O59618:
LNK  O28778_ARCFU/14-189:O28778:AE000999
LNK  Q8PVJ5_METMA/16-196:Q8PVJ5:AE013434
LNK  Q8ZMP7_SALTY/31-215:Q8ZMP7:AE008825
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  GPI2_RHIME/27-194
ASQ  VKTFRDLAGLYRDESAYQALIATRGDDVAYEVTDYKPSANGGD------IIIGVTRMEPGKIGDEYFMTRGHIHAR-----PNRPEMYYGEAGVGVMLLES-PHG----------EIRTIEMRARTMCYVPPFWIHRSVNVGLEPLVMTFSYPADAGQDYDVIAKAGGMRTVLSMTGTVDGPQSITPVIQ
DSQ  GTCAAAACCTTCCGGGATCTTGCAGGGCTGTATCGGGACGAAAGCGCATATCAAGCGCTTATCGCAACCCGCGGTGATGATGTCGCCTATGAGGTTACGGACTACAAGCCATCGGCCAATGGGGGTGAC------------------ATCATCATCGGCGTCACGCGCATGGAGCCTGGGAAGATCGGTGACGAGTATTTCATGACGCGGGGCCACATCCATGCGAGG---------------CCCAATCGGCCGGAAATGTATTATGGCGAGGCTGGGGTAGGCGTGATGCTGCTGGAATCG---CCCCATGGC------------------------------GAGATTCGCACGATCGAGATGCGCGCGAGGACTATGTGCTATGTGCCACCCTTTTGGATCCATCGTTCTGTCAACGTCGGCCTGGAACCACTTGTAATGACATTTTCCTATCCCGCGGATGCCGGTCAGGACTACGACGTCATTGCGAAGGCGGGGGGAATGCGGACCGTATTGTCGATGACGGGAACGGTGGATGGACCACAGTCGATAACGCCGGTTATTCAG
TRN  10010101100011011
NAM  GPI1_RHIME/27-194
ASQ  QKRFRDLAGLYADEAAFSAMQETWNDTVVYEVSEFRPNERTGD------LIFGVTRMLPGKVGEEYFVTRGHIHKQ-----SDRPEIYYGQKGRGLMLLES-PEG----------EVRVVAVDAQTVCYVPPYWIHRSVNIGGDELVMLFCYPADSGQDYDCIAKAGGMRARIIDDGRGGWKQIDNPNWR
DSQ  CAGAAACGCTTCCGCGATCTCGCCGGTCTTTATGCCGACGAGGCGGCATTCTCTGCCATGCAGGAAACCTGGAACGATACGGTCGTCTACGAGGTCTCGGAGTTCCGCCCCAACGAACGCACCGGCGAC------------------CTCATTTTCGGCGTCACCCGCATGCTGCCGGGCAAGGTGGGCGAAGAGTATTTCGTCACCCGCGGCCACATTCACAAGCAA---------------TCGGACCGGCCGGAAATCTACTACGGTCAGAAGGGCCGCGGCCTCATGCTGCTGGAATCT---CCGGAGGGC------------------------------GAAGTCCGCGTCGTGGCCGTCGACGCGCAGACGGTCTGCTACGTGCCGCCGTACTGGATCCACCGGTCGGTGAATATCGGCGGCGACGAGCTCGTGATGCTCTTCTGCTACCCTGCCGACTCTGGCCAGGACTACGACTGCATCGCCAAGGCGGGCGGCATGCGTGCGCGCATCATCGATGACGGCAGGGGCGGCTGGAAACAGATCGACAACCCCAACTGGCGG
TRN  10010101100011011
NAM  GPI_PYRHO/24-186
ASQ  VRRLSDMKGYFLDEETWRELVE-REDPVVYEVYAVEQEEKEGD------LNFATTVLYPGKVGKEFFFTKGHFHAK-----RDRAEVYIALKGKGGMLLQT-PEG----------EARWIPMEPGTVVYVPPYWAHRTVNTGDEPFIFLAIYPADAGHDYGTIAEKGFSKIVIEENG----EVKVVDNPR
NAM  Q8ZMP7_SALTY/31-215
ASQ  GRKSAGQMAVVLPE-----FTEGLRNEPAYDVYRGLSFAEDQERLAADQYQYDITIIMPGTIGKERKKTSGHYHGYNDTRRNTHPEVYEVIKGTAAYILQKSPDFAAAPQELVVDDLIVAVVKEGQSIIVPPNYGHCSINIGDGPLVFSNLAYKPCTVHYDTVQFYHGMACYIVEENGQLCVRKNHYYPR
DSQ  GGCCGCAAAAGCGCCGGGCAGATGGCGGTGGTTTTACCGGAG---------------TTCACCGAAGGGCTGCGTAATGAACCGGCTTACGATGTTTATCGCGGTCTCAGCTTTGCGGAGGATCAGGAACGGCTTGCTGCTGACCAGTATCAGTACGACATCACCATCATCATGCCGGGGACGATTGGCAAGGAGCGTAAGAAAACCAGTGGCCATTATCACGGCTATAACGACACGCGGCGCAACACCCATCCGGAGGTGTATGAAGTAATTAAGGGTACGGCGGCGTATATCCTGCAAAAGTCGCCGGATTTTGCCGCCGCGCCGCAGGAGCTGGTGGTAGACGATCTTATCGTGGCCGTCGTGAAGGAGGGGCAGAGCATTATCGTGCCGCCGAATTATGGCCACTGCTCCATCAATATCGGCGACGGGCCGCTGGTGTTCAGCAATCTGGCGTATAAACCCTGTACGGTTCACTACGACACGGTGCAGTTTTACCACGGTATGGCCTGCTACATCGTGGAGGAGAACGGGCAGCTCTGCGTGCGCAAGAATCACTACTACCCGCGT
TRN  11011101101011010
NAM  Q8PVJ5_METMA/16-196
ASQ  VRKLHDMEDVVFDREWFEKTDE-MNRDMYYMFRDLARSDSDLEIIKSRHLRYDITRIPPGMLGSEYIKTVGHYHPQVPGTDVSYPEIYQVLEGSATYLLQK-VEP---GEEEIVLDVAVIKAEKGDLVLVPPGYGHVTINSSENTLEMANWVCGDFSSFYEPIKRLSGAAYFLLKDG----FAKNPLYRN
DSQ  GTAAGAAAACTCCATGATATGGAAGATGTGGTATTTGATAGAGAATGGTTTGAAAAGACCGATGAA---ATGAACAGAGATATGTATTATATGTTCAGGGATCTTGCCAGAAGTGATTCTGATCTTGAGATTATCAAATCCCGCCACCTCAGGTATGACATTACAAGAATCCCTCCCGGAATGCTCGGGTCGGAGTATATTAAAACCGTTGGCCACTACCATCCTCAAGTTCCGGGAACAGACGTCTCCTATCCTGAGATTTACCAGGTGCTTGAAGGCTCAGCTACCTACCTGCTGCAAAAG---GTGGAGCCC---------GGAGAAGAAGAAATTGTTCTGGACGTTGCGGTTATCAAGGCTGAAAAAGGGGATCTGGTTCTTGTTCCACCAGGATACGGGCACGTAACAATAAATTCCTCTGAAAATACTCTTGAGATGGCAAACTGGGTTTGCGGGGACTTCTCTTCGTTCTATGAGCCTATAAAGAGGCTTTCCGGAGCCGCCTATTTCCTACTTAAAGACGGT------------TTTGCCAAAAACCCCCTTTATAGAAAT
TRN  10010101100011001
NAM  O28778_ARCFU/14-189
ASQ  VRKASDLKPVLAFPEALKE-----DFDAYYMFRDSFKTDEEAEIIRNAGLRYDYTVIPPNNIGGESIKTYGHYHPEVV-RGFTYPEVYQVLEGEALFILQK-PSN------GKIEDVIVVEGKKWDTVIIPPNYGHVTINPTESDLITANWVCRNFSSIYEPYTKRRGACYYYI-NGEWVRNRNYDDAPE
DSQ  GTTAGAAAAGCCTCTGATTTAAAACCCGTTCTTGCTTTTCCCGAAGCACTTAAGGAA---------------GATTTTGACGCTTACTACATGTTCAGGGATTCCTTCAAAACAGACGAGGAGGCGGAGATTATCAGAAATGCAGGGCTGAGATACGACTACACGGTTATACCGCCAAACAACATAGGTGGAGAGAGCATTAAAACTTACGGCCACTATCATCCGGAAGTTGTA---AGGGGCTTTACCTATCCTGAAGTTTACCAGGTGCTTGAGGGAGAGGCCCTTTTCATACTGCAAAAG---CCTTCAAAC------------------GGAAAAATCGAGGATGTGATAGTCGTTGAGGGGAAGAAGTGGGACACAGTAATAATTCCACCAAACTACGGTCACGTGACCATTAACCCGACTGAGAGCGATTTAATCACCGCAAACTGGGTGTGCAGGAACTTCAGCTCCATCTACGAACCCTACACGAAGAGGAGGGGCGCTTGCTACTACTACATC---AACGGGGAGTGGGTCAGAAACAGGAACTACGATGATGCTCCAGAA
TRN  10010101100011000
//