EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06397 - Desulfoferrod_N)
FAM  PF06397
PID  Desulfoferrod_N
DES  Desulfoferrodoxin, N-terminal domain
IPR  IPR004462
ANO  9
ALN  36
AID  0.549551
APH  (((((DESR_ARCFU/2-37:0.10685,(Q9FDN8_MOOTH/2-37:0.26441,DESR_METTH/2-37:0.25472):0.17662):0.11989,(DESR_DESVM/1-36:0.13626,DESR_DESDE/1-36:0.16021):0.19181):0.10133,DESR_DESBR/2-37:0.15373):0.36427,DESR_DESGI/1-36:0.44109):0.22992,Q8TJP6_METAC/4-39:0.18512,Q9PJ99_CAMJE/1-36:0.50463);
ATP  (((((DESR_ARCFU/2-37,(Q9FDN8_MOOTH/2-37,DESR_METTH/2-37)),(DESR_DESVM/1-36,DESR_DESDE/1-36)),DESR_DESBR/2-37),DESR_DESGI/1-36),Q8TJP6_METAC/4-39,Q9PJ99_CAMJE/1-36);
ATL  3.39112
DNO  8
DLN  108
DID  0.558201
DPH  ((DESR_DESBR/2-37:0.27944,(DESR_DESVM/1-36:0.06410,((Q8TJP6_METAC/4-39:0.22550,Q9PJ99_CAMJE/1-36:0.39348):0.16814,DESR_DESGI/1-36:0.27189):0.22931):0.07821):0.13650,(DESR_ARCFU/2-37:0.20795,DESR_METTH/2-37:0.26519):0.06704,Q9FDN8_MOOTH/2-37:0.21287);
DTP  ((DESR_DESBR/2-37,(DESR_DESVM/1-36,((Q8TJP6_METAC/4-39,Q9PJ99_CAMJE/1-36),DESR_DESGI/1-36))),(DESR_ARCFU/2-37,DESR_METTH/2-37),Q9FDN8_MOOTH/2-37);
DTL  2.59962
RID  0.540504
RPH  (((((DESR_ARCFU/2-37:0.10069,(Q9FDN8_MOOTH/2-37:0.26385,DESR_METTH/2-37:0.26137):0.18868):0.10434,DESR_DESVM/1-36:0.29858):0.11541,DESR_DESBR/2-37:0.16047):0.36976,DESR_DESGI/1-36:0.44508):0.23166,Q8TJP6_METAC/4-39:0.18739,Q9PJ99_CAMJE/1-36:0.51074);
RTP  (((((DESR_ARCFU/2-37,(Q9FDN8_MOOTH/2-37,DESR_METTH/2-37)),DESR_DESVM/1-36),DESR_DESBR/2-37),DESR_DESGI/1-36),Q8TJP6_METAC/4-39,Q9PJ99_CAMJE/1-36);
RTL  3.23293
LNK  DESR_ARCFU/2-37:O29425:AE001047
LNK  DESR_DESBR/2-37:Q46495:X99543
LNK  DESR_DESDE/1-36:P22076:
LNK  DESR_DESGI/1-36:P00273:M62784
LNK  DESR_DESVM/1-36:P48345:D76419
LNK  DESR_METTH/2-37:O26851:AE000854
LNK  Q8TJP6_METAC/4-39:Q8TJP6:AE011085
LNK  Q9FDN8_MOOTH/2-37:Q9FDN8:AF202316
LNK  Q9PJ99_CAMJE/1-36:Q9PJ99:AL139074
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9PJ99_CAMJE/1-36
ASQ  MRQYETYKCQKCGNEVEVQNVGGGKLSCCGEEMKCI
DSQ  ATGAGACAATATGAAACCTATAAATGCCAAAAATGTGGCAATGAAGTAGAAGTTCAAAATGTAGGTGGCGGTAAGCTTAGTTGTTGTGGTGAAGAAATGAAATGTATC
TRN  10010101110011011
NAM  DESR_DESGI/1-36
ASQ  ANEGDVYKCELCGQVVKVLEEGGGTLVCCGEDMVKQ
DSQ  GCGAACGAAGGCGACGTGTACAAGTGTGAACTGTGCGGCCAGGTGGTGAAAGTGCTGGAAGAAGGCGGCGGCACGCTGGTGTGCTGCGGCGAGGATATGGTCAAGCAG
TRN  11011101101011011
NAM  Q8TJP6_METAC/4-39
ASQ  SRKGEKYRCEICGNEVVVTEVGGGTLVCCGEDMTLI
DSQ  TCCAGAAAAGGAGAAAAGTACCGCTGCGAGATCTGCGGCAACGAAGTCGTTGTAACAGAAGTAGGAGGCGGAACACTTGTTTGCTGCGGAGAAGATATGACTCTCATT
TRN  10010101110011011
NAM  DESR_DESDE/1-36
ASQ  PKHLEVYKCTHCGNIVEVLHGGGAELVCCGEPMKHM
NAM  DESR_DESVM/1-36
ASQ  PNMLEVYKCVHCGNIVEVMHAGGGDLVCCGEPMKFM
DSQ  CCGAACATGCTCGAAGTCTACAAGTGCGTTCACTGTGGCAACATCGTCGAAGTCATGCACGCCGGCGGCGGCGACCTGGTCTGCTGCGGCGAACCCATGAAGTTCATG
TRN  11011111101111111
NAM  DESR_METTH/2-37
ASQ  TETNQIFRCNVCGNIVEVLNPGAGQLVCCNQPMELL
DSQ  ACAGAAACCAACCAGATATTCAGATGCAACGTCTGCGGAAATATCGTTGAAGTCCTTAACCCCGGAGCTGGACAGCTTGTATGCTGTAATCAGCCCATGGAACTACTG
TRN  10010101100011011
NAM  DESR_DESBR/2-37
ASQ  PERLQVYKCEVCGNIVEVLNGGIGELVCCNQDMKLM
DSQ  CCCGAGAGGCTTCAAGTTTACAAATGTGAGGTTTGCGGAAACATCGTCGAGGTTCTCAACGGCGGGATTGGCGAACTGGTCTGTTGCAACCAGGACATGAAGTTGATG
TRN  10010101100011011
NAM  DESR_ARCFU/2-37
ASQ  TEVMQVYKCMVCGNIVEVVHAGRGQLVCCGQPMKLM
DSQ  ACGGAAGTTATGCAGGTGTATAAGTGCATGGTTTGTGGAAATATTGTGGAAGTGGTGCATGCCGGAAGGGGACAGCTAGTTTGCTGCGGGCAGCCGATGAAGCTGATG
TRN  10010101100011011
NAM  Q9FDN8_MOOTH/2-37
ASQ  AAITQVYKCNICGNIVTILHPGGGALVCCGKPMELL
DSQ  GCGGCAATCACCCAGGTTTACAAGTGCAATATATGCGGTAATATTGTTACCATCCTGCATCCGGGCGGGGGTGCCCTGGTTTGCTGCGGCAAACCCATGGAGTTACTG
TRN  10010101100011010
//