EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06368 - Met_asp_mut_E)
FAM  PF06368
PID  Met_asp_mut_E
DES  Methylaspartate mutase E chain (MutE)
IPR  IPR006396
ANO  5
ALN  445
AID  0.401406
APH  (Q9HN20_HALN1/41-473:0.48833,((Q9F2E2_STRTE/4-416:1.32541,Q8RHY5_FUSNN/42-482:0.53920):0.18923,GLME_CLOTT/42-482:0.24829):0.07242,O66144_CITAM/43-481:0.25996);
ATP  (Q9HN20_HALN1/41-473,((Q9F2E2_STRTE/4-416,Q8RHY5_FUSNN/42-482),GLME_CLOTT/42-482),O66144_CITAM/43-481);
ATL  3.12284
DNO  5
DLN  1335
DID  0.465024
DPH  (((Q9HN20_HALN1/41-473:0.32309,Q9F2E2_STRTE/4-416:0.67583):0.17225,O66144_CITAM/43-481:0.15591):0.34769,Q8RHY5_FUSNN/42-482:0.49904,GLME_CLOTT/42-482:0.15928);
DTP  (((Q9HN20_HALN1/41-473,Q9F2E2_STRTE/4-416),O66144_CITAM/43-481),Q8RHY5_FUSNN/42-482,GLME_CLOTT/42-482);
DTL  2.33309
RID  0.401406
RPH  (Q9HN20_HALN1/41-473:0.48833,((Q9F2E2_STRTE/4-416:1.32541,Q8RHY5_FUSNN/42-482:0.53920):0.18923,GLME_CLOTT/42-482:0.24829):0.07242,O66144_CITAM/43-481:0.25996);
RTP  (Q9HN20_HALN1/41-473,((Q9F2E2_STRTE/4-416,Q8RHY5_FUSNN/42-482),GLME_CLOTT/42-482),O66144_CITAM/43-481);
RTL  3.12284
LNK  GLME_CLOTT/42-482:Q05509:X70499
LNK  O66144_CITAM/43-481:O66144:AB005294
LNK  Q8RHY5_FUSNN/42-482:Q8RHY5:AE010487
LNK  Q9F2E2_STRTE/4-416:Q9F2E2:AJ250581
LNK  Q9HN20_HALN1/41-473:Q9HN20:AE005113
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9HN20_HALN1/41-473
ASQ  LPPHKRFAAVLENA---EAVLCQPRAGVPRLDEHVELLQHLDEEGGADLLPTTIDSYTRDNAYEKAAEGLARSRETDSSELNGFPAVNHGVEGCREVVRRV---DAPVQVRHGTPDARLLAAVTLAGGFQSFEGGPITYNLPYTSAYDLETTIEYWQYVDRLCGAYTERGVTINREPFGP-LTGTLVPPSIAIAIVTIEGLLAATQGVRSVTLGYGQVGNLVQDVAAVRAMAAIGAEYLP----DSVTVTTVLHQWMGGFPRDEARAHGVIGLAGATAALVEPTKVITKSPQEAVGVPTAESNAAGLRTTDQVLRMLDEQSIT-LDGVDREQALIERSVRSLLDAVYEAGDGDIARGTVRAFDAGTLDIPFPPSDAAAGDVLPARDDDGRVRLLKFGAVALDDETKRIHRARLDRRADTEGRELSFRMVADDVSAVSDGRLIGRP
DSQ  CTGCCGCCCCACAAGCGGTTCGCGGCGGTGCTTGAGAACGCC---------GAGGCGGTGTTGTGCCAGCCCCGCGCCGGCGTGCCCCGCCTCGACGAGCACGTCGAGTTGCTCCAGCACCTCGACGAGGAAGGCGGCGCGGACCTCCTGCCGACCACCATCGACTCGTACACCCGGGACAACGCCTACGAGAAGGCCGCCGAGGGGCTGGCGCGCTCCCGGGAGACCGACAGCAGCGAGCTCAACGGCTTTCCCGCCGTCAACCACGGCGTTGAGGGCTGCCGGGAGGTCGTGCGCCGGGTC---------GACGCGCCCGTGCAGGTCAGACACGGCACCCCCGACGCGCGCCTGCTGGCCGCGGTCACGCTTGCGGGCGGGTTCCAGAGCTTCGAGGGCGGGCCGATCACGTACAACCTCCCGTACACGAGTGCCTACGATCTAGAGACGACCATCGAGTACTGGCAGTACGTCGACCGGCTCTGTGGGGCGTACACGGAGCGCGGGGTCACGATCAACCGCGAGCCGTTCGGTCCG---CTGACGGGGACGCTCGTCCCGCCGTCGATCGCCATCGCGATCGTCACCATCGAGGGGCTGCTGGCGGCAACCCAGGGCGTCCGCAGCGTCACGCTGGGGTACGGCCAGGTCGGCAACCTCGTCCAAGACGTCGCTGCGGTGCGCGCGATGGCGGCCATCGGGGCGGAGTACCTGCCC------------GACTCGGTGACCGTCACGACAGTGCTCCACCAGTGGATGGGGGGGTTCCCGCGCGACGAGGCGCGGGCCCACGGCGTCATCGGGCTGGCCGGCGCGACCGCTGCGCTCGTCGAACCCACGAAGGTCATCACCAAATCCCCCCAGGAGGCGGTGGGCGTGCCGACGGCGGAATCGAACGCCGCGGGCCTGCGCACGACCGATCAGGTGCTGCGGATGCTCGACGAGCAGTCGATCACG---CTGGACGGCGTCGACAGGGAGCAGGCGTTGATCGAGCGGTCGGTGCGATCACTGCTCGATGCGGTGTACGAGGCCGGCGACGGCGACATCGCGCGTGGCACGGTGCGGGCGTTCGACGCGGGGACGCTTGACATCCCGTTCCCACCCAGCGACGCGGCGGCGGGTGACGTGCTCCCGGCCCGCGACGACGACGGCCGGGTTCGCCTGCTGAAGTTCGGGGCGGTGGCGCTGGACGACGAGACGAAGCGAATCCACCGCGCGCGACTGGACCGCCGCGCGGACACCGAAGGCCGGGAGCTCTCGTTCCGGATGGTGGCCGACGACGTGTCGGCGGTCAGCGATGGGCGGCTCATCGGCCGCCCG
TRN  10010101100011001
NAM  GLME_CLOTT/42-482
ASQ  VPTEKNFADKLVRAKEAGITLAQPRAGVALLDEHINLLRYLQDEGGADLLPSTIDAYTRQNRYEECEIGIKESEKAGRSLLNGFPGVNHGVKGCRKVLESV---NLPLQARHGTPDSRLLAEIIHAGGWTSNEGGGISYNIPYAKSVPIDKCLKDWQYCDRLVGFYEEQGVHINREPFGP-LTGTLVPPSMSNAVGITEALLAAEQGVKNITVGYGECGNMLQDIAALRCLEEQTNEYLKAYGYNDVFVTTVFHQWMGGFPQDESKAFGVIVTATTIASLAGATKVIVKTPHEAIGIPTKEANASGIKATKMALNMLEGQRMPMSKELETEMAIIKAETKCILDKMFELGKGDLAVGTVKAFETGVMDIPFGPSKYNAGKMMPVRDNLGCVRYLEFGNVPFTEELKNYNRERLAERAKFEGREVSFQMVIDDIFAVGKGRLIGRP
DSQ  GTACCAACAGAAAAGAACTTTGCTGATAAATTAGTTAGAGCAAAAGAAGCAGGAATAACTTTAGCTCAGCCAAGAGCAGGTGTTGCATTACTTGATGAACATATTAATTTATTAAGATATTTACAAGATGAAGGTGGCGCAGATTTATTACCTTCAACAATTGATGCATATACAAGACAGAATAGATATGAAGAATGTGAAATTGGTATAAAAGAAAGTGAAAAAGCTGGAAGATCATTATTAAATGGTTTCCCAGGAGTTAACCATGGTGTTAAAGGTTGTAGAAAGGTTTTAGAATCAGTA---------AACTTACCTCTACAAGCTAGACATGGTACACCAGATTCAAGATTACTTGCTGAAATAATTCACGCTGGTGGATGGACTTCAAATGAAGGAGGCGGTATCTCCTACAACATTCCATACGCTAAATCAGTTCCAATTGATAAATGTTTAAAAGATTGGCAGTATTGCGATAGACTTGTTGGTTTCTATGAAGAACAAGGAGTTCATATAAACAGAGAACCATTCGGACCA---TTAACAGGAACACTTGTACCACCATCAATGTCAAATGCAGTAGGAATTACAGAAGCTTTACTTGCAGCAGAACAAGGAGTTAAAAACATCACTGTTGGATATGGTGAGTGTGGAAACATGCTTCAGGATATAGCTGCATTAAGATGTTTAGAAGAACAGACAAATGAATACCTAAAAGCTTATGGATACAATGATGTATTTGTAACAACAGTATTCCATCAGTGGATGGGTGGATTCCCTCAAGATGAATCCAAAGCATTTGGCGTTATAGTAACAGCTACAACTATAGCATCATTAGCAGGAGCAACTAAAGTTATAGTTAAGACTCCACATGAAGCTATTGGTATACCAACAAAAGAAGCTAATGCTTCAGGTATCAAAGCTACAAAGATGGCATTAAATATGTTAGAAGGACAGAGAATGCCAATGTCAAAAGAATTAGAAACTGAAATGGCAATTATAAAAGCTGAAACTAAATGCATACTTGATAAGATGTTTGAATTAGGAAAAGGTGATTTAGCAGTAGGTACTGTTAAAGCATTCGAAACTGGTGTTATGGATATACCATTTGGACCAAGCAAATACAATGCAGGAAAAATGATGCCAGTTAGAGACAACTTAGGATGCGTAAGATACCTAGAATTCGGTAACGTTCCATTTACTGAAGAATTAAAGAATTATAACAGAGAAAGATTAGCTGAAAGAGCTAAATTCGAAGGAAGAGAAGTTAGCTTCCAGATGGTTATTGATGATATATTTGCAGTAGGTAAAGGAAGACTTATCGGAAGACCA
TRN  10010101110011000
NAM  O66144_CITAM/43-481
ASQ  IPEKKRFSHALLKADQEGKTLSQPRAGVALMDEHIELLKTLQVE--CDLLPSTIDAYTRLNRYEEAAIGIQKSIEAGTSKLNGLPVVNHGVAACRRMTEAL---EKPIQVRHGTPDARLLAEIAMASGFTSYEGGGISYNIPYAKRVTLEKSIRDWQYCDRLMGLYEEHGIRINREPFGP-LTGTLIPPFMSHAVAIIEGLLALEQGVKSITVGYGQVGSLTQDIAAIQSLRELSHEYFQNYGFSDYELSTVFHQWMGGFPEDESKAFAIISWGAAVAGMSGATKVITKSPHEAFGIPTAAANARGLRASRQMLNMVSDQKFPPCAAVEQEVDLIKSEVRAVLKKVFELGNGDVARGTVLAFEAGVLDVPFAPASCNAGKILPVRDNSGAIRVLEAGSVPLPKDILALHHDYVAERAHFEGRKPSFQMVVDDINAVSHSQLIGRP
DSQ  ATTCCTGAGAAAAAACGTTTCTCTCATGCCTTGTTGAAGGCGGATCAGGAAGGGAAAACCCTGAGCCAACCGCGTGCCGGCGTTGCGCTGATGGATGAGCACATCGAACTGCTGAAAACCCTACAGGTAGAG------TGCGACCTGCTGCCCAGCACCATCGATGCCTACACCCGTTTGAATCGTTATGAAGAAGCCGCTATTGGGATCCAGAAATCCATCGAAGCCGGGACCTCAAAGCTCAACGGACTGCCGGTGGTGAACCACGGCGTGGCGGCCTGCCGTCGGATGACCGAAGCGCTG---------GAGAAACCGATTCAGGTACGCCACGGTACGCCGGATGCGCGTCTGCTGGCGGAAATTGCCATGGCCAGCGGCTTCACCAGCTATGAAGGCGGCGGTATCTCCTACAACATTCCTTACGCCAAGCGCGTCACGCTGGAAAAATCTATTCGCGACTGGCAGTACTGCGACCGTCTGATGGGGCTGTATGAAGAACATGGCATTCGCATTAACCGCGAACCGTTTGGCCCG---CTGACCGGCACGCTGATCCCGCCATTCATGTCTCACGCGGTGGCGATTATCGAAGGTCTGCTGGCGCTGGAACAGGGCGTGAAGTCCATCACCGTCGGTTACGGCCAGGTGGGCAGTCTGACGCAGGACATTGCTGCTATCCAGTCACTGCGCGAACTGTCCCACGAATATTTCCAGAACTACGGTTTCAGTGATTACGAACTGAGCACCGTCTTCCACCAGTGGATGGGCGGCTTCCCGGAAGACGAATCCAAAGCGTTCGCCATTATCTCCTGGGGTGCAGCGGTCGCCGGTATGTCCGGTGCTACCAAAGTGATCACCAAGAGCCCGCACGAAGCCTTCGGTATCCCAACCGCGGCGGCTAACGCCAGGGGACTGCGCGCATCGCGTCAGATGCTCAATATGGTCAGCGATCAGAAATTCCCGCCGTGTGCAGCAGTAGAACAGGAAGTGGATCTGATTAAGAGCGAAGTTCGCGCGGTCCTCAAGAAAGTGTTTGAGCTGGGCAACGGCGATGTCGCGCGCGGTACGGTACTGGCCTTTGAAGCAGGCGTCCTGGATGTGCCTTTCGCCCCAGCCTCCTGCAATGCCGGGAAAATCCTGCCGGTTCGCGACAACTCCGGCGCTATCCGCGTTCTGGAAGCCGGCTCGGTTCCGCTGCCGAAAGACATTCTCGCCCTGCACCACGACTATGTTGCCGAGCGCGCGCATTTCGAAGGACGTAAACCCTCATTCCAGATGGTTGTTGATGACATCAACGCTGTATCCCACAGTCAATTAATAGGAAGACCA
TRN  10010101100011000
NAM  Q8RHY5_FUSNN/42-482
ASQ  LPDHKNFQKKIEQSVQDNKIMTQAHSKETLLEDLIKNLNTFYRVGQADFLSIIIDSHTRENHYDNAKVILEDSIKSNKSLLNGFPLINYGTKLARKIINDV---EVPLQIKHGSPDARLLVEVALLSGFSAFDGGGISHNIPFSKSISLKDSLENWKYVDRLVGIYEENGIKINREIFSP-LTATLVPPAISNSIQILETLLAVEQGVKNISIGVAQYGNITQDIASLLALKEHIQFYLDTFSFKDINISTVFNQWIGGFPEEELKAYSLISYSTTIALFSKTNRIFVKNIDEYAKNSLGNTMINSLLLTKTILDIGNNQKINNYEEIIFEKEQIKKETAQIIAKIFSRCDGDLRKAIIEAFEYGVLDVPFAPSKYNLGKMMPARDSEGMIRYLDIGNLPFCPLIEEFHNKKIKERSMKENREINFQMTIDDIFAMSQGKLINKK
DSQ  CTGCCAGATCATAAAAATTTCCAAAAAAAGATAGAACAGTCTGTACAAGATAATAAAATAATGACACAGGCACATAGTAAAGAAACACTATTAGAAGATTTAATAAAAAATTTAAATACTTTTTATAGAGTTGGACAGGCAGATTTTCTTTCAATTATAATAGATTCTCATACTAGAGAAAACCATTATGATAATGCAAAAGTTATTTTGGAAGATTCTATAAAATCTAATAAATCTCTTTTAAATGGTTTTCCATTAATAAATTATGGAACAAAATTAGCTAGAAAAATTATAAATGATGTA---------GAAGTTCCATTACAAATAAAACATGGCTCACCTGATGCAAGACTATTAGTTGAAGTTGCACTATTAAGTGGTTTTTCAGCTTTTGATGGCGGTGGAATTAGTCATAATATACCTTTTAGTAAATCTATTTCATTAAAAGATAGCTTAGAAAATTGGAAGTATGTAGATAGACTTGTTGGAATTTATGAAGAAAATGGAATAAAAATAAATAGAGAAATTTTTTCTCCA---CTTACTGCTACACTTGTTCCACCAGCAATTTCTAACTCAATACAAATTTTAGAAACTTTACTTGCTGTTGAACAAGGTGTAAAAAATATAAGTATAGGAGTTGCTCAGTATGGAAATATCACACAAGATATTGCTAGCTTACTAGCTCTTAAAGAGCACATACAATTTTATTTAGATACTTTTTCTTTTAAGGATATTAATATCTCAACTGTATTTAATCAGTGGATAGGTGGATTTCCAGAAGAGGAGCTAAAAGCCTACTCTTTAATTTCTTATTCTACAACTATTGCCTTGTTTTCTAAAACTAATAGAATATTCGTAAAAAATATAGATGAGTATGCTAAAAATTCACTAGGTAATACTATGATTAACTCACTGCTTCTAACTAAGACTATATTAGATATTGGTAATAACCAAAAAATCAATAATTATGAAGAAATAATTTTTGAAAAAGAACAAATAAAGAAGGAAACTGCTCAAATAATTGCAAAAATTTTCTCAAGATGTGATGGTGATTTAAGAAAAGCTATTATAGAAGCTTTTGAATATGGTGTGCTTGATGTTCCTTTTGCTCCTTCAAAATATAATTTAGGAAAAATGATGCCTGCAAGGGATAGTGAAGGAATGATAAGGTATTTAGATATTGGTAATTTACCTTTCTGTCCTTTGATAGAGGAATTTCATAATAAAAAAATTAAAGAAAGATCAATGAAAGAAAATAGAGAAATAAATTTTCAAATGACTATTGATGATATATTTGCAATGAGTCAAGGAAAATTAATAAATAAGAAA
TRN  10010101100011000
NAM  Q9F2E2_STRTE/4-416
ASQ  PTGPGRFTRFVRRASSEGKLVVQPRMGFGTVEQMRAGLDAVRIVDAATVGTITVDSYTRVNDHASALLALEKGAD-----LNGFPLVAHGAAATRELLAGIAGDDFPVQVRHGSALPGALFEGLVAAGIDATEGGPVSYCLPYSR-VPLAQAVDAWAECCEMLAGTSEP---VHLESFGGCMLGQLCPPSLLISLSILEGLFFREHGLRDISVSYAQQTNQQQDLEAIHALRALAKEWLG-----DTDWHAVLYTYMGVYPRTRQGAYRLLEESARLAARSGTERLIVKTAVEASRIPSITENVDALERAAR---AAEREAVA--EPAGIPDSGIYEEAQAIITHTLTLGS-DVGKALVRAFALGHLDIPFCLHQDNANRCRARHRRPWPAHLGRPRRWPIP-----------RARALPGNRQRLTARGLLEMLSY-NERRYDHP
DSQ  CCCACCGGCCCCGGACGCTTCACCCGGTTCGTCCGGCGGGCGTCGAGCGAAGGGAAACTGGTCGTCCAGCCGCGCATGGGGTTCGGCACGGTCGAGCAGATGCGCGCGGGACTCGACGCGGTCAGGATCGTCGACGCGGCCACGGTGGGCACCATCACCGTCGACAGCTACACGCGGGTGAACGATCACGCCTCGGCCCTTCTCGCTCTGGAGAAGGGCGCGGAC---------------CTCAACGGGTTCCCGCTGGTGGCCCACGGCGCGGCGGCCACCCGCGAGCTGCTCGCCGGAATCGCGGGCGACGACTTCCCGGTGCAGGTGAGGCACGGCTCGGCGTTGCCCGGCGCATTGTTCGAGGGACTGGTGGCGGCCGGCATCGACGCCACCGAAGGCGGCCCTGTCTCCTACTGCCTGCCGTATAGCCGC---GTCCCTCTGGCGCAAGCCGTCGACGCCTGGGCGGAATGCTGCGAGATGCTCGCGGGAACCAGCGAACCG---------GTGCATCTGGAGAGTTTCGGCGGCTGTATGCTGGGACAGTTGTGCCCGCCGAGCCTGTTGATCTCCCTGAGCATTCTGGAAGGCTTGTTCTTCCGCGAACACGGACTGCGGGACATTTCCGTCAGCTACGCCCAGCAGACGAATCAGCAACAGGACCTCGAGGCGATCCACGCCCTGCGCGCCCTGGCGAAGGAATGGCTCGGA---------------GACACCGACTGGCACGCCGTCCTGTACACCTACATGGGCGTTTATCCCCGCACCCGGCAGGGGGCGTACAGGCTCCTCGAGGAGAGTGCGAGGCTCGCCGCCAGATCCGGGACCGAGCGGTTGATCGTCAAGACCGCGGTGGAGGCCAGCAGAATCCCGTCGATCACGGAGAACGTCGACGCCCTGGAACGCGCCGCGAGG---------GCGGCCGAGCGGGAGGCGGTGGCC------GAACCGGCCGGAATCCCGGACTCCGGGATCTACGAGGAGGCCCAGGCGATCATCACGCACACGCTGACCCTCGGCAGT---GATGTCGGAAAGGCGCTCGTCCGCGCGTTCGCCCTCGGACACCTCGACATCCCGTTCTGCCTGCACCAGGACAACGCGAACCGCTGCCGGGCCCGGCATCGACGACCGTGGCCGGCTCACCTGGGCCGACCCCGCAGGTGGCCGATTCCC---------------------------------CGGGCGCGCGCTCTGCCCGGGAACCGGCAGCGGCTCACCGCCCGGGGCCTCCTCGAGATGCTCAGTTAC---AACGAACGGCGCTACGACCACCCG
TRN  10010101100011011
//