EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06177 - DUF988)
FAM  PF06177
PID  DUF988
DES  Protein of unknown function (DUF988)
IPR  IPR010387
ANO  12
ALN  173
AID  0.366994
APH  ((Q8R9P2_THETN/5-160:0.98558,((Q8DQ01_STRR6/29-193:0.17798,(Q8DT48_STRMU/5-170:0.24393,(Q8P1L2_STRP8/5-166:0.12985,Q8E085_STRA5/7-169:0.23656):0.07012):0.08886):0.14838,Q9CHD7_LACLA/26-190:0.21344):0.24169):0.19806,(O05109_LACPL/5-165:0.71374,(Q8ET24_OCEIH/2-158:0.39186,Q8Y8M9_LISMO/2-159:0.30457):0.19841):0.23339,(Q8XKA2_CLOPE/5-164:0.56793,(Q8RAG9_THETN/5-156:1.01297,Q97GF4_CLOAB/6-163:0.66985):0.17293):0.48398);
ATP  ((Q8R9P2_THETN/5-160,((Q8DQ01_STRR6/29-193,(Q8DT48_STRMU/5-170,(Q8P1L2_STRP8/5-166,Q8E085_STRA5/7-169))),Q9CHD7_LACLA/26-190)),(O05109_LACPL/5-165,(Q8ET24_OCEIH/2-158,Q8Y8M9_LISMO/2-159)),(Q8XKA2_CLOPE/5-164,(Q8RAG9_THETN/5-156,Q97GF4_CLOAB/6-163)));
ATL  7.48408
DNO  12
DLN  519
DID  0.486932
DPH  ((((((((Q8P1L2_STRP8/5-166:0.17961,Q8E085_STRA5/7-169:0.20180):0.06864,Q8DT48_STRMU/5-170:0.22810):0.05987,Q8DQ01_STRR6/29-193:0.21265):0.11906,Q9CHD7_LACLA/26-190:0.22639):0.17424,(Q8ET24_OCEIH/2-158:0.38111,(O05109_LACPL/5-165:0.59075,Q8Y8M9_LISMO/2-159:0.24058):0.08386):0.22992):0.07784,Q8R9P2_THETN/5-160:0.44244):0.22841,Q8XKA2_CLOPE/5-164:0.33541):0.13381,Q8RAG9_THETN/5-156:0.56374,Q97GF4_CLOAB/6-163:0.37690);
DTP  ((((((((Q8P1L2_STRP8/5-166,Q8E085_STRA5/7-169),Q8DT48_STRMU/5-170),Q8DQ01_STRR6/29-193),Q9CHD7_LACLA/26-190),(Q8ET24_OCEIH/2-158,(O05109_LACPL/5-165,Q8Y8M9_LISMO/2-159))),Q8R9P2_THETN/5-160),Q8XKA2_CLOPE/5-164),Q8RAG9_THETN/5-156,Q97GF4_CLOAB/6-163);
DTL  5.15513
RID  0.366994
RPH  ((Q8R9P2_THETN/5-160:0.98558,((Q8DQ01_STRR6/29-193:0.17798,(Q8DT48_STRMU/5-170:0.24393,(Q8P1L2_STRP8/5-166:0.12985,Q8E085_STRA5/7-169:0.23656):0.07012):0.08886):0.14838,Q9CHD7_LACLA/26-190:0.21344):0.24169):0.19806,(O05109_LACPL/5-165:0.71374,(Q8ET24_OCEIH/2-158:0.39186,Q8Y8M9_LISMO/2-159:0.30457):0.19841):0.23339,(Q8XKA2_CLOPE/5-164:0.56793,(Q8RAG9_THETN/5-156:1.01297,Q97GF4_CLOAB/6-163:0.66985):0.17293):0.48398);
RTP  ((Q8R9P2_THETN/5-160,((Q8DQ01_STRR6/29-193,(Q8DT48_STRMU/5-170,(Q8P1L2_STRP8/5-166,Q8E085_STRA5/7-169))),Q9CHD7_LACLA/26-190)),(O05109_LACPL/5-165,(Q8ET24_OCEIH/2-158,Q8Y8M9_LISMO/2-159)),(Q8XKA2_CLOPE/5-164,(Q8RAG9_THETN/5-156,Q97GF4_CLOAB/6-163)));
RTL  7.48408
LNK  O05109_LACPL/5-165:O05109:X99978
LNK  Q8DQ01_STRR6/29-193:Q8DQ01:AE008465
LNK  Q8DT48_STRMU/5-170:Q8DT48:AE014986
LNK  Q8E085_STRA5/7-169:Q8E085:AE014230
LNK  Q8ET24_OCEIH/2-158:Q8ET24:BA000028
LNK  Q8P1L2_STRP8/5-166:Q8P1L2:AE010012
LNK  Q8R9P2_THETN/5-160:Q8R9P2:AE013112
LNK  Q8RAG9_THETN/5-156:Q8RAG9:AE013088
LNK  Q8XKA2_CLOPE/5-164:Q8XKA2:BA000016
LNK  Q8Y8M9_LISMO/2-159:Q8Y8M9:AL591977
LNK  Q97GF4_CLOAB/6-163:Q97GF4:AE007742
LNK  Q9CHD7_LACLA/26-190:Q9CHD7:AE006312
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx......xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9CHD7_LACLA/26-190
ASQ  KTYDIVTIAIVAALYVILTMTPGLSAISYGPIQFRVSEMLNFTAFFNKKYIIAVTIGCMISNFL-S-FTWVDVIVGGLSTLVFLSLGVLLFDRFKKDYFWNGQLNKAF..FFFAIFFSISMFTIALELKFVA.GTPFLLTWGTLALGEFASLFS-GAFVMDKLGKR--VDLSR
DSQ  AAAACTTATGATATTGTTACAATCGCAATTGTTGCGGCCCTGTATGTTATTCTAACGATGACACCAGGTTTGAGCGCAATTTCTTACGGACCTATTCAATTTCGAGTATCAGAAATGTTGAATTTTACAGCCTTCTTCAATAAAAAATATATTATTGCGGTGACAATTGGTTGTATGATTTCAAACTTTTTA---TCT---TTCACTTGGGTAGATGTGATTGTCGGTGGTTTGTCAACTTTAGTATTCTTAAGTCTTGGTGTCCTTTTGTTTGACCGCTTTAAAAAAGATTATTTTTGGAATGGTCAGTTAAATAAAGCATTT......TTCTTTTTTGCAATTTTCTTTTCGATAAGTATGTTCACCATTGCTCTTGAATTAAAATTTGTCGCA...GGAACACCATTTTTGCTGACCTGGGGGACATTAGCTCTAGGTGAATTTGCCAGCTTATTTAGC---GGGGCATTTGTCATGGATAAATTAGGTAAAAGA------GTTGATTTGAGTCGT
TRN  10010101100011000
NAM  Q8E085_STRA5/7-169
ASQ  --RDYAHMAIVTAIYIVLTITPPFNAIAYGAYQFRVSEMLNFLAFYHRKYLFAVTLGCMISNLY-S-FGMIDVFVGGGSTLLFVYLGTILFKQYQKDYLFNGLINKAF..FFFSFFFAASMITVAVELKIVA.GLPLLLTWLTTAVGELASLLV-GAVLVDKLSRH--VDFTK
DSQ  ------CGCGATTACGCTCACATGGCTATTGTAACAGCTATCTATATCGTTTTAACCATAACGCCACCTTTTAATGCTATTGCTTATGGTGCTTATCAATTCCGTGTTTCAGAAATGCTAAATTTCTTGGCCTTTTACCACCGAAAATACCTTTTTGCGGTAACGTTAGGATGTATGATTTCTAATCTTTAT---AGT---TTTGGAATGATTGATGTCTTTGTAGGTGGTGGTTCAACCTTACTTTTTGTTTATCTTGGAACCATTTTATTCAAGCAATATCAAAAAGATTATCTATTTAATGGCCTTATTAACAAAGCATTC......TTTTTCTTTTCTTTCTTCTTTGCTGCTTCAATGATTACGGTAGCAGTTGAATTGAAAATTGTAGCA...GGATTACCTTTATTATTAACATGGTTAACGACAGCTGTTGGTGAATTGGCTTCACTTTTGGTT---GGAGCAGTCCTTGTGGATAAGTTGAGTAGACAC------GTCGATTTTACAAAA
TRN  10010101110011000
NAM  Q8P1L2_STRP8/5-166
ASQ  TVHDYVHIGLVAALYVVLTITPPLNAISYGMYQFRISEMMNFLAFYHRKYIIAVTLGCMIANFY-S-FGLIDVFVGGGSTLIFVTLGVILFSKYQKDYLFNGIFNKAF..VYFSFFFATSMFTVAIELYFF-.GAPFLLTWFTTALGELISLLI-GSLIIDKLSQR--ISF--
DSQ  ACTGTACACGACTATGTTCACATTGGGCTAGTAGCTGCCTTGTATGTTGTCTTAACTATTACCCCACCTTTAAATGCGATTTCTTATGGGATGTATCAATTTAGAATATCTGAAATGATGAATTTCTTAGCTTTTTATCATCGCAAGTATATTATTGCGGTGACTCTTGGATGTATGATTGCTAACTTTTAT---AGT---TTCGGACTGATTGATGTCTTTGTAGGCGGCGGTTCAACTCTTATTTTTGTGACCTTAGGTGTGATTTTGTTTAGTAAGTATCAAAAAGATTATCTTTTTAATGGCATTTTTAATAAAGCTTTT......GTTTACTTTTCTTTCTTTTTTGCAACTTCCATGTTTACTGTAGCAATCGAACTTTACTTCTTT---...GGAGCTCCATTTTTATTAACATGGTTTACAACTGCGTTAGGAGAATTAATATCTCTGCTCATA---GGATCACTTATTATTGATAAGTTGTCTCAAAGA------ATTTCCTTT------
TRN  10010101100011000
NAM  Q8DT48_STRMU/5-170
ASQ  TVRDLAHIAIVAALYVALTATPPLNAISYGGIQFRLSEMLNFLAFYNPKYIIAVTLGCMIANTFGT-IGLLDVFVGGGSTLVFVTLGLILFSKYKKEYIFNGLFNKAF..FYFSVFYAIFMVTIAAEISLVL.QTPFLLTWITVAVGELISSLF-GALVIDKLAQY--IDFTR
DSQ  ACTGTTCGTGATTTAGCCCATATCGCCATTGTGGCGGCCTTATATGTCGCCTTGACTGCGACTCCGCCGTTAAATGCCATCTCTTATGGTGGTATACAATTTCGGCTTTCAGAAATGCTTAATTTTTTAGCTTTCTATAATCCTAAATACATCATTGCTGTTACTCTAGGCTGTATGATTGCCAATACTTTTGGGACT---ATTGGTCTTCTTGATGTCTTTGTCGGCGGTGGTTCAACCTTAGTTTTTGTAACATTAGGCCTGATCCTTTTTTCTAAGTATAAAAAGGAATACATTTTTAATGGCCTCTTTAATAAGGCCTTC......TTTTACTTTTCTGTGTTTTACGCTATATTTATGGTAACGATAGCAGCGGAAATTTCTCTTGTTCTC...CAAACGCCATTTTTACTGACTTGGATAACTGTAGCAGTAGGAGAATTGATTTCCTCTCTTTTT---GGAGCTCTTGTGATTGATAAATTGGCCCAATAT------ATAGATTTTACAAGA
TRN  10010101100011000
NAM  Q8DQ01_STRR6/29-193
ASQ  TIRDVADIAIVAAIYVVLTVTPPLNAISYGAYQFRISEMMNFMAFYNPKYIIGVTIGCMIANFF-S-FGLLDVFVGGGSTLVFLSLGVWLFAKYSKDYLFNGLIRKDH..FFFSILFSISMFTIAAELNIVA.ELPFFLTWFTTGIGEFASLII-GAIIIGKIGRR--IDLSK
DSQ  ACTATTCGTGATGTTGCAGATATTGCAATCGTCGCTGCTATCTACGTCGTTTTGACTGTCACACCGCCCCTAAATGCCATCAGCTATGGTGCTTATCAGTTTCGTATTTCAGAAATGATGAACTTTATGGCTTTTTACAATCCTAAGTACATCATCGGAGTTACCATCGGTTGTATGATTGCTAATTTCTTT---AGC---TTCGGACTGCTAGATGTCTTTGTTGGTGGTGGTTCAACCTTAGTATTCCTCAGTTTAGGTGTTTGGCTTTTTGCAAAATATAGCAAGGATTACCTCTTTAACGGATTGATTCGAAAAGATCAT......TTCTTCTTTTCAATCCTCTTTTCAATTTCCATGTTTACTATCGCTGCAGAGTTAAATATTGTAGCA...GAATTACCATTCTTCCTTACTTGGTTTACAACAGGAATCGGTGAATTTGCTTCATTGATTATT---GGAGCGATTATTATTGGTAAAATTGGTCGTCGA------ATTGATTTAAGTAAA
TRN  11011101101011000
NAM  Q8Y8M9_LISMO/2-159
ASQ  KMKILTVNAIIAALYVVLGMI--VAPIGFMALQFRIPEIFNHLIVFNKKYFWGIIVGVFITNLFFSGLGWIDLVFGVAQSAISLLL-MIGISKYVKGIIPRMIIN---..---TILFSVTMAIIAWELVIVF.DLPFLITWATTAASEFIVMGV-GIPLMYLLNKR--LNFRK
DSQ  AAAATGAAAATTTTGACGGTGAATGCAATTATCGCTGCACTGTATGTAGTGCTCGGAATGATT------GTCGCGCCCATTGGGTTTATGGCATTACAATTTAGAATACCAGAAATCTTTAACCACCTAATCGTTTTTAATAAAAAATACTTTTGGGGTATTATCGTAGGCGTTTTTATTACGAATTTGTTCTTTTCCGGATTAGGTTGGATTGATTTAGTTTTTGGCGTAGCACAATCGGCTATCTCGCTTTTACTA---ATGATTGGCATTTCTAAATACGTTAAAGGAATTATTCCGCGGATGATTATTAAT---------......---------ACGATTCTCTTCTCTGTAACGATGGCAATTATCGCATGGGAGCTAGTAATCGTTTTT...GACTTACCTTTCCTAATTACTTGGGCAACAACAGCTGCAAGTGAATTCATTGTGATGGGCGTC---GGGATTCCGCTAATGTATCTATTAAATAAACGG------TTGAATTTCCGTAAA
TRN  10010101100011010
NAM  Q8ET24_OCEIH/2-158
ASQ  NVKTLVINGVIAALYVVVSLF--IAPFGFTNIQFRISEMFNHLIVFDKRYFFGIVIGVFIVNLNSP-LGWYDLVFGVAHSAISLGI-IIFLSKFIKNKLTLLFLN---..---TIVFTFNMFIIAFALNLAL.ELPFWITWFTTAIGEFGVLLI-GIPIFYALHKR--LRFDK
DSQ  AACGTAAAAACATTAGTAATTAATGGTGTAATAGCGGCACTATATGTCGTTGTTTCTTTATTT------ATTGCGCCATTTGGTTTTACAAATATACAGTTTCGCATTTCCGAGATGTTCAATCATCTAATTGTATTTGATAAGCGTTATTTCTTTGGAATTGTAATTGGAGTGTTTATCGTTAACCTCAATTCACCA---CTTGGTTGGTATGACCTCGTATTCGGGGTTGCGCACTCTGCTATTTCACTAGGAATT---ATTATTTTCTTATCTAAATTTATTAAGAACAAGTTGACGCTACTATTTCTAAAT---------......---------ACGATTGTATTCACGTTTAATATGTTTATCATTGCATTTGCATTAAACCTTGCACTC...GAACTTCCATTTTGGATCACTTGGTTTACAACTGCAATCGGGGAATTTGGTGTACTGTTGATC---GGTATCCCTATATTCTACGCATTGCACAAGCGC------TTGCGATTTGATAAG
TRN  10010101100011000
NAM  O05109_LACPL/5-165
ASQ  KIRPWIINALVAAMYVVLCLGPAAFSLASGAIQFRVSEGLNHLAVFNRKYIWGIVAGVILFDAFGPGASLLNVLFGGGQSLLALLVLTWLAPK-LKTVWQRMLLN---..---IALFTVSMFMIALMITMMSsGVAFWPTYLTTALSELIIMSI-TAPIMYSLDRV--LHFSD
DSQ  AAAATTCGACCATGGATTATCAACGCCCTAGTCGCTGCAATGTATGTTGTATTATGCCTAGGCCCCGCAGCTTTTAGCTTGGCATCGGGCGCAATTCAATTCCGCGTTTCTGAAGGGTTGAACCACTTAGCCGTGTTCAATCGCAAGTATATTTGGGGAATTGTTGCTGGCGTTATTTTGTTTGACGCTTTTGGTCCCGGTGCGAGTCTCCTCAACGTTCTCTTTGGTGGCGGCCAATCATTATTAGCCCTGCTGGTATTGACGTGGTTGGCCCCTAAG---TTGAAGACGGTTTGGCAACGGATGTTACTGAAT---------......---------ATCGCGCTATTCACCGTTTCGATGTTTATGATCGCACTGATGATTACCATGATGAGTagtGGTGTCGCTTTTTGGCCGACATATCTAACAACTGCTTTATCAGAGTTGATTATCATGAGTATC---ACTGCGCCAATTATGTACAGCTTGGATCGGGTC------TTGCACTTTAGTGAC
TRN  11011101101011000
NAM  Q8R9P2_THETN/5-160
ASQ  RIKDLAEIALVAAIYFALTII--FSSISFLPVQFRIGEITKSIVVFNKKYAISMMIGNFFANLFSPFAGAMELIFMPLSNLIGCTIG----------YYIGRLTHKAIgaIFIALWIAAS---VAITLKVSA.GIPFIPTFLSVGVAETVLLVT-GYFLLFTIEKKGVVKFDR
DSQ  AGAATAAAAGATTTAGCTGAAATTGCTCTTGTTGCAGCAATTTATTTCGCACTCACAATTATA------TTTTCGTCCATTTCGTTTTTACCCGTTCAATTTCGAATCGGGGAAATTACGAAATCCATTGTAGTATTCAATAAAAAATATGCTATTTCCATGATGATAGGAAATTTTTTTGCAAATTTGTTTAGCCCATTTGCTGGTGCAATGGAATTAATTTTTATGCCTCTTTCGAACTTAATAGGCTGTACAATTGGA------------------------------TACTACATTGGAAGACTTACTCACAAAGCGATAggagctATATTCATAGCCCTTTGGATTGCAGCATCA---------GTTGCAATTACTTTAAAGGTTTCTGCA...GGCATACCATTTATTCCGACTTTCTTAAGCGTGGGAGTAGCGGAAACTGTACTTTTGGTAACT---GGATATTTTTTGCTTTTCACAATTGAAAAGAAAGGAGTTGTGAAATTTGACAGA
TRN  10010101110011000
NAM  Q97GF4_CLOAB/6-163
ASQ  TLRILISNALIAAVYAVLTLT--LYFSAYGQIQVRVAEALTILPFFSGYYIVGLTLGCFVANIFS--IMKMDMLFGTLATFIAACL-TYFIGKS-KVQFKKYIA----..--PLPPVIVNAVIVGMELKIVT.HAPFLVNAICVGVGELVACYVFGLPLLAVIEKNKVLKKFM
DSQ  ACTTTAAGAATTTTAATATCAAATGCGCTTATAGCAGCAGTTTATGCTGTTCTTACGTTGACG------TTATATTTTTCTGCTTATGGGCAAATTCAAGTAAGGGTAGCAGAAGCATTAACAATATTGCCGTTTTTTTCGGGATATTATATTGTAGGGCTTACTTTGGGGTGTTTTGTAGCAAATATATTTAGC------ATTATGAAGATGGATATGTTATTTGGAACTTTAGCTACTTTTATAGCGGCATGCTTA---ACATACTTTATTGGTAAGAGT---AAAGTTCAATTTAAGAAATATATTGCA------------......------CCTCTGCCACCTGTAATAGTTAATGCAGTAATTGTTGGAATGGAATTAAAGATAGTAACT...CATGCTCCTTTTTTAGTAAATGCGATTTGTGTAGGAGTAGGAGAGCTAGTAGCTTGTTATGTTTTTGGACTTCCGCTATTAGCAGTTATAGAAAAAAATAAAGTGCTAAAAAAGTTCATG
TRN  10010101100011000
NAM  Q8XKA2_CLOPE/5-164
ASQ  NIKRIVISALIAALYATLTIA--LAPISYLGVQFRISEIMVLLAFYKKDYIVGLTLGCFIANILGP-NGTIDIVLGTFATFISVW-GIYLTGKYIKGKKAIWIAS---..---IWPTIFNGIIIGWMLNYVY.GLPLVLSMGQVALGEFVIITVIGVPVFNFINKKYFGKLNI
DSQ  AATATAAAAAGAATAGTTATATCAGCACTTATTGCAGCTTTATATGCAACCTTAACAATAGCT------TTAGCACCTATAAGTTATTTAGGGGTACAATTTAGAATATCAGAAATTATGGTTCTTTTAGCCTTTTATAAAAAAGATTATATAGTAGGATTGACCCTAGGATGTTTCATAGCAAATATATTAGGGCCA---AATGGTACTATTGATATTGTTTTAGGAACCTTTGCAACCTTTATAAGTGTTTGG---GGAATTTATTTAACTGGTAAATATATAAAAGGAAAGAAAGCTATATGGATTGCTTCA---------......---------ATTTGGCCAACAATATTTAATGGTATTATAATAGGTTGGATGCTTAATTATGTTTAT...GGACTACCTTTAGTGTTATCAATGGGACAGGTTGCCTTAGGTGAGTTTGTTATAATAACAGTAATAGGAGTTCCTGTATTTAATTTTATAAATAAAAAATATTTTGGTAAATTAAATATT
TRN  10010101110011000
NAM  Q8RAG9_THETN/5-156
ASQ  DVKYIAKAGVIAAIYFAVTFL--LGSVSYGPIQFRLSEALVVLPMIEPAAIWGVFIGCLLANIGSP-FGIIDILGGSFVTLIAAYL----TSKAKKFYQA--------..--ILPPIILNALFVSIWVSYFL.KMPYYIVAIDIALSEAIVTGVFGYAVLIA-YKRIKDRYSL
DSQ  GATGTAAAATACATTGCGAAAGCGGGAGTTATTGCAGCAATTTATTTTGCAGTGACTTTTTTG------CTCGGCAGTGTCTCCTATGGCCCTATTCAGTTTAGGCTTTCAGAGGCTTTGGTGGTTCTGCCGATGATAGAGCCGGCGGCTATCTGGGGTGTTTTCATTGGATGTCTTTTAGCAAATATAGGGAGTCCC---TTTGGCATTATAGATATTTTAGGAGGGAGTTTTGTAACCCTTATAGCTGCGTACCTT------------ACATCAAAGGCAAAAAAGTTTTATCAGGCT------------------------......------ATTTTGCCTCCCATTATTTTGAACGCTTTGTTTGTTTCAATATGGGTGAGCTATTTCCTA...AAAATGCCTTATTACATTGTGGCAATTGACATTGCATTGAGTGAGGCAATTGTGACAGGTGTATTTGGGTATGCTGTTTTAATTGCC---TATAAAAGGATTAAAGACAGATACTCACTG
TRN  10010101100011000
//