EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF06057 - VirJ)
FAM  PF06057
PID  VirJ
DES  Bacterial virulence protein (VirJ)
IPR  IPR010333
ANO  12
ALN  194
AID  0.4262
APH  ((Q8P8D8_XANCP/218-409:0.23161,Q9PFC4_XYLFA/34-225:0.41365):0.34171,(((Q44405_9RHIZ/261-454:0.57910,Q8UCG5_AGRT5/261-454:0.01062):0.23213,(Q53472_9ZZZZ/52-244:0.43377,Q8GQE4_RHITR/265-458:0.18442):0.15155):0.10004,Q92QW4_RHIME/1-190:0.21188):0.26220,((Q8FW75_BRUSU/190-378:0.56222,Q9I538_PSEAE/232-422:0.61102):0.12908,(Q8XPW5_RALSO/410-600:0.39794,(Q8PMQ8_XANAC/265-455:0.13806,Q9PA41_XYLFA/263-452:0.29765):0.20515):0.28860):0.05425);
ATP  ((Q8P8D8_XANCP/218-409,Q9PFC4_XYLFA/34-225),(((Q44405_9RHIZ/261-454,Q8UCG5_AGRT5/261-454),(Q53472_9ZZZZ/52-244,Q8GQE4_RHITR/265-458)),Q92QW4_RHIME/1-190),((Q8FW75_BRUSU/190-378,Q9I538_PSEAE/232-422),(Q8XPW5_RALSO/410-600,(Q8PMQ8_XANAC/265-455,Q9PA41_XYLFA/263-452))));
ATL  5.83665
DNO  12
DLN  582
DID  0.519031
DPH  (((Q8XPW5_RALSO/410-600:0.27664,(Q8PMQ8_XANAC/265-455:0.09338,Q9PA41_XYLFA/263-452:0.38347):0.17678):0.11609,(Q8P8D8_XANCP/218-409:0.19647,Q9PFC4_XYLFA/34-225:0.39442):0.18927):0.06025,(Q9I538_PSEAE/232-422:0.37008,Q8FW75_BRUSU/190-378:0.40561):0.09230,(Q92QW4_RHIME/1-190:0.18575,((Q53472_9ZZZZ/52-244:0.41252,Q8GQE4_RHITR/265-458:0.13641):0.08539,(Q44405_9RHIZ/261-454:0.36808,Q8UCG5_AGRT5/261-454:0.00000):0.19281):0.08091):0.15652);
DTP  (((Q8XPW5_RALSO/410-600,(Q8PMQ8_XANAC/265-455,Q9PA41_XYLFA/263-452)),(Q8P8D8_XANCP/218-409,Q9PFC4_XYLFA/34-225)),(Q9I538_PSEAE/232-422,Q8FW75_BRUSU/190-378),(Q92QW4_RHIME/1-190,((Q53472_9ZZZZ/52-244,Q8GQE4_RHITR/265-458),(Q44405_9RHIZ/261-454,Q8UCG5_AGRT5/261-454))));
DTL  4.37315
RID  0.4262
RPH  ((Q8P8D8_XANCP/218-409:0.23161,Q9PFC4_XYLFA/34-225:0.41365):0.34171,(((Q44405_9RHIZ/261-454:0.57910,Q8UCG5_AGRT5/261-454:0.01062):0.23213,(Q53472_9ZZZZ/52-244:0.43377,Q8GQE4_RHITR/265-458:0.18442):0.15155):0.10004,Q92QW4_RHIME/1-190:0.21188):0.26220,((Q8FW75_BRUSU/190-378:0.56222,Q9I538_PSEAE/232-422:0.61102):0.12908,(Q8XPW5_RALSO/410-600:0.39794,(Q8PMQ8_XANAC/265-455:0.13806,Q9PA41_XYLFA/263-452:0.29765):0.20515):0.28860):0.05425);
RTP  ((Q8P8D8_XANCP/218-409,Q9PFC4_XYLFA/34-225),(((Q44405_9RHIZ/261-454,Q8UCG5_AGRT5/261-454),(Q53472_9ZZZZ/52-244,Q8GQE4_RHITR/265-458)),Q92QW4_RHIME/1-190),((Q8FW75_BRUSU/190-378,Q9I538_PSEAE/232-422),(Q8XPW5_RALSO/410-600,(Q8PMQ8_XANAC/265-455,Q9PA41_XYLFA/263-452))));
RTL  5.83665
LNK  Q44405_9RHIZ/261-454:Q44405:D13800
LNK  Q53472_9ZZZZ/52-244:Q53472:M18059
LNK  Q8FW75_BRUSU/190-378:Q8FW75:AE014292
LNK  Q8GQE4_RHITR/265-458:Q8GQE4:AF433669
LNK  Q8P8D8_XANCP/218-409:Q8P8D8:AE012338
LNK  Q8PMQ8_XANAC/265-455:Q8PMQ8:AE011768
LNK  Q8UCG5_AGRT5/261-454:Q8UCG5:AE009198
LNK  Q8XPW5_RALSO/410-600:Q8XPW5:AL646085
LNK  Q92QW4_RHIME/1-190:Q92QW4:AL591786
LNK  Q9I538_PSEAE/232-422:Q9I538:AE004526
LNK  Q9PA41_XYLFA/263-452:Q9PA41:AE004073
LNK  Q9PFC4_XYLFA/34-225:Q9PFC4:AE003916
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9PFC4_XYLFA/34-225
ASQ  SDRLAIMISGDGGWRTLDRNLSKELQRRGISVVGWNSLRYFWKLRTPEQLGDDLSRVIADYQRRWGAHQVILIGYSFGADVMPFAYAHLMPTQRNGVDFISLLALGRKADFKARIFGWLGWGEHGTR-DVLTALGALDLHRVQCIYGQNDKD-AVCPELRERIFDVVMRPGGHHFDGDTVKLADAILQGWQRRI
DSQ  AGTGATCGGCTGGCGATTATGATCTCCGGTGATGGTGGTTGGCGCACACTGGATCGTAATTTATCGAAGGAATTACAGCGCCGTGGTATTTCCGTCGTGGGATGGAATAGCCTGCGTTACTTCTGGAAGCTGCGTACCCCTGAGCAGCTGGGTGACGATCTTAGCCGCGTCATTGCCGACTATCAGCGGCGTTGGGGTGCCCACCAAGTCATCCTGATCGGTTATTCATTTGGTGCCGACGTCATGCCATTTGCCTACGCTCACTTGATGCCGACGCAGCGCAACGGCGTTGATTTTATTTCTTTGCTTGCTCTAGGTCGCAAGGCCGATTTTAAAGCCCGGATTTTTGGTTGGCTGGGATGGGGCGAGCATGGCACCCGG---GATGTTTTGACGGCCTTAGGCGCGCTTGATTTGCACCGTGTGCAATGCATCTATGGACAGAATGATAAAGAT---GCCGTGTGTCCAGAATTGCGTGAACGGATATTCGATGTTGTGATGCGTCCCGGCGGTCATCACTTCGACGGCGATACTGTCAAACTTGCCGATGCGATCTTACAAGGGTGGCAGCGGCGGATT
TRN  10010101100011000
NAM  Q8P8D8_XANCP/218-409
ASQ  SDRLVVLLSGDGGWREMDKGIAARLQQQGVSVVGFNSLRYFWGSRTPQQVGVDLDRIIATYQQRWHAHHVALVGYSFGADVLPFAFPELPAARRDAVQFVGLLGLAHQADFKVRVGGWLGWHNEAER-PIAPALQALDAHRLQCIYGEQEKD-TLCPELRARGVEVIARPGGHHFDRDPGALADILLQGWQRAA
DSQ  AGCGATCGTCTGGTCGTGCTGCTCTCCGGCGACGGCGGCTGGCGCGAGATGGACAAAGGCATTGCTGCACGCCTGCAGCAACAGGGCGTGTCGGTGGTCGGCTTCAACAGCCTGCGCTACTTCTGGGGCAGCCGCACGCCGCAGCAGGTGGGTGTGGATCTGGACCGGATCATCGCCACTTACCAGCAGCGCTGGCATGCGCATCACGTGGCCTTGGTGGGCTATTCGTTCGGTGCGGATGTGTTGCCGTTCGCATTTCCCGAACTGCCGGCGGCGCGCCGCGATGCGGTGCAGTTTGTCGGCTTGCTGGGCCTGGCCCATCAGGCCGACTTCAAGGTGCGGGTGGGCGGTTGGCTGGGCTGGCACAACGAGGCCGAGCGC---CCGATCGCCCCCGCGCTGCAGGCGCTCGATGCGCATCGGCTGCAATGCATTTATGGCGAACAGGAGAAGGAC---ACCTTGTGCCCGGAGCTGCGCGCGCGCGGCGTAGAGGTCATTGCACGTCCTGGCGGCCACCACTTCGACCGTGACCCGGGTGCGCTGGCCGACATCCTGCTGCAGGGCTGGCAGCGCGCAGCG
TRN  11011101101011011
NAM  Q9PA41_XYLFA/263-452
ASQ  SDTFAIFVSGDGGWAEIDKKVAGHLADADIPVVGLDSLRYFWSERTPEGFAKDLDRIARFYAHHWKRNRLLLVGFSQGADVLPAAINKLSPNTRQIIRMTALLSLGKYAHYEFHVSNWISTDDEGI--PIAPDMVKLRSTRTVCIYGVDDQE-TLCPSLPQQNR-RVALPGTHHFNGDYETVAKTILAQMEAAP
DSQ  AGTGACACCTTTGCAATCTTTGTTTCTGGCGACGGAGGCTGGGCCGAAATCGACAAGAAGGTGGCAGGACATCTGGCCGATGCTGATATTCCAGTAGTGGGCTTGGATTCACTGCGGTACTTCTGGAGCGAACGTACCCCGGAAGGCTTTGCCAAAGATCTGGACCGCATTGCACGCTTTTACGCTCACCACTGGAAGCGTAACCGCTTGTTGCTGGTCGGATTCTCTCAAGGTGCAGACGTGCTGCCTGCAGCGATTAATAAGCTTTCCCCCAACACTCGCCAAATTATCCGTATGACTGCACTGTTGTCGTTAGGAAAATATGCGCACTACGAATTTCATGTCAGCAACTGGATATCCACAGACGACGAGGGTATA------CCGATTGCACCAGACATGGTCAAGTTGAGATCCACAAGAACTGTGTGTATCTATGGCGTGGATGATCAAGAA---ACACTGTGCCCATCATTACCGCAACAGAATCGT---CGCGTTGCCTTACCGGGCACACATCACTTTAATGGTGATTATGAAACTGTTGCCAAAACTATCTTGGCGCAAATGGAAGCTGCACCT
TRN  10010101100011000
NAM  Q8PMQ8_XANAC/265-455
ASQ  DDTFVIFVSGDGGWAGLDEEVADALAAQGIPVVGLDSLRYFWTERTPQGFADDLDRIARIYAQRWDRQRVVLIGFSQGADVLPAAINKLPAATKQNLRMTALLSVGKLADYEFHVSNWLGSDDEGL--PIAPEVQRLPAGTTVCIYGQDDDD-ALCPSLPANVARRVALPGDHHFKGDYATLAKTIMDQLHALS
DSQ  GACGACACGTTCGTGATCTTCGTTTCTGGCGATGGCGGTTGGGCCGGGCTGGACGAAGAAGTGGCCGACGCACTCGCCGCGCAAGGCATTCCGGTCGTTGGCCTGGATTCGCTGCGTTACTTCTGGACCGAGCGCACGCCGCAAGGTTTTGCCGACGACCTGGATCGCATCGCCCGCATCTATGCGCAGCGCTGGGATCGTCAGCGCGTGGTATTGATCGGGTTTTCGCAGGGTGCCGACGTGCTGCCGGCCGCCATCAACAAACTGCCGGCGGCGACCAAGCAGAACCTGCGCATGACGGCGCTGTTGTCGGTCGGCAAGCTGGCCGACTACGAATTCCACGTCAGCAACTGGCTGGGCTCGGATGACGAGGGCCTG------CCGATCGCACCGGAAGTTCAGCGTCTGCCGGCCGGCACGACGGTGTGCATCTACGGCCAGGACGACGACGAT---GCGCTGTGCCCAAGCCTGCCCGCAAACGTGGCCAGGCGGGTCGCACTGCCGGGCGATCACCACTTCAAGGGCGATTACGCGACCCTGGCCAAGACGATCATGGACCAGTTGCACGCGCTGTCG
TRN  10010101100011011
NAM  Q8XPW5_RALSO/410-600
ASQ  SELFAVLLSGDGGWAGLDKEVAAALSKSGVPVVGVDSLRYFWTPRTPASAAADMDRLVRFYAARWKKTKALLIGYSQGADVLPFIVNRLPAASREHVALAVMMGLGKRADFEFHMTNWVSSSASGL--LILPEVQKLPTGLGMCIYGRDEKD-SNCPSLDPKQVQLVKLPGGHHFDGDYAKLARIILEGARGPG
DSQ  TCGGAACTGTTTGCCGTGCTGCTGTCGGGCGACGGCGGCTGGGCCGGGCTCGACAAGGAGGTGGCGGCCGCGCTGTCGAAATCTGGCGTGCCGGTGGTCGGCGTGGATTCGCTGCGCTATTTCTGGACGCCGCGCACGCCCGCTTCCGCGGCGGCCGACATGGACCGCCTGGTGCGCTTCTATGCCGCGCGCTGGAAGAAGACGAAGGCCCTGCTGATCGGCTATTCGCAGGGCGCGGATGTCCTGCCCTTCATCGTCAACCGCCTGCCGGCCGCCTCGCGCGAGCACGTCGCGCTGGCGGTGATGATGGGGCTGGGCAAGCGCGCCGATTTCGAGTTCCACATGACCAACTGGGTGTCGAGCAGCGCGTCGGGCCTG------CTGATCCTGCCGGAGGTGCAGAAGCTGCCCACGGGCCTGGGCATGTGCATCTACGGCCGCGACGAGAAGGAT---TCCAACTGCCCGTCGCTGGATCCAAAGCAGGTGCAGCTGGTCAAGCTGCCCGGCGGGCATCACTTCGACGGCGATTACGCCAAGCTGGCGCGCATCATCCTGGAAGGCGCGCGCGGGCCGGGG
TRN  11011101101011011
NAM  Q92QW4_RHIME/1-190
ASQ  ---MAVIYSGDGGWRDIDKEVGNALQQQGVPVVGVDSLRYFWSERQPQATADDLARVITYYGRRWNVRNVLLIGYSFGADILPRTYNLLPSATRARVRQVTLMALSHRADYKISVLGWLGADGEGNAGDPVDDIKAIEPALVQCIYGTDEED-DACPDLKSSGIDVVSIEGGHHFDGDYAALTRRVLDALDRRL
DSQ  ---------ATGGCGGTGATCTATTCCGGCGACGGCGGCTGGCGCGACATCGACAAGGAGGTCGGCAATGCCCTGCAGCAGCAGGGCGTGCCCGTCGTCGGGGTGGATTCGCTTCGCTATTTCTGGTCGGAGCGCCAGCCGCAGGCGACGGCGGACGATCTCGCCCGTGTCATCACCTATTACGGCAGGCGGTGGAACGTCCGCAATGTACTGTTGATCGGCTATTCCTTCGGCGCCGACATCCTGCCGCGCACCTACAACCTGCTTCCGTCAGCGACCCGCGCGCGCGTACGGCAGGTAACGCTCATGGCGCTGTCGCATCGCGCCGACTACAAGATCTCCGTCCTCGGCTGGCTCGGCGCCGACGGAGAGGGGAATGCCGGCGACCCGGTCGACGACATCAAGGCGATCGAGCCGGCGCTCGTGCAGTGCATCTACGGCACCGACGAGGAGGAC---GATGCCTGCCCGGATCTGAAATCCTCCGGCATCGACGTGGTTTCCATCGAGGGAGGCCATCATTTCGATGGCGACTACGCCGCTCTGACACGACGCGTGCTCGATGCGCTCGACCGCCGGCTG
TRN  10010101100011001
NAM  Q8UCG5_AGRT5/261-454
ASQ  MDTMAVIYSGDGGWRDLDEEVGSALQKQGVPVIGVDALRYFWKEKDPKEVAGDLARIIDTYRKEWKVKNVVLIGYSFGADIIPATYNLLPDRVKSSVAQLSLLGLSNEVDFEISVQGWLGVAGEGKGGKTVDDIAKIDPKLVQCVYGTEEEDEDPCPGLKAKGVETIGIEGGHHFDEDYEALAKRIVTSLKTRL
DSQ  ATGGACACCATGGCGGTGATCTATTCCGGCGATGGCGGCTGGCGCGACCTGGACGAGGAAGTCGGCAGCGCCCTTCAGAAGCAGGGTGTGCCGGTCATTGGCGTCGATGCCCTGCGGTATTTCTGGAAGGAAAAGGATCCGAAAGAGGTGGCGGGCGATCTCGCCCGCATCATCGACACCTATCGCAAGGAATGGAAGGTCAAGAATGTCGTTCTGATCGGTTATTCCTTCGGTGCCGATATCATTCCCGCCACCTACAATCTCCTGCCCGACCGGGTGAAATCCTCCGTTGCGCAGCTTTCGCTGCTCGGCCTTTCCAATGAAGTGGATTTTGAAATCTCAGTTCAGGGATGGCTTGGCGTGGCTGGTGAAGGCAAGGGCGGCAAGACCGTCGATGACATCGCCAAGATCGACCCCAAGCTGGTGCAATGCGTTTATGGCACCGAGGAGGAAGATGAAGATCCCTGCCCCGGCCTCAAGGCAAAGGGTGTCGAAACCATCGGCATCGAAGGCGGGCACCATTTCGACGAGGATTACGAAGCGCTTGCCAAACGCATCGTCACCTCGCTGAAAACCAGGCTG
TRN  10010101100011001
NAM  Q8GQE4_RHITR/265-458
ASQ  EDTLAIVYSGDGGWRDIDKEVGSYLQDQGIPVVGVDTLHYFWTEKDPQQTANDLGRIIDFYTKRFKVKHVVLVGYSFGADVLPASYNRLPQAEKDKIVQMSLLSLSQKVDYVISVMGWLGASSQGKGGDPVNDLKSINPKMVQCVYGKDDDEDVACPLLKGTGAEVIAMDGGHHFDDDYEALANHIINGLKSRL
DSQ  GAAGACACGCTCGCAATCGTCTATTCGGGTGATGGCGGCTGGCGCGACATCGACAAGGAAGTCGGCAGCTACCTGCAGGACCAAGGCATCCCGGTCGTGGGCGTCGATACCCTGCATTATTTCTGGACGGAGAAGGATCCGCAGCAGACGGCCAACGACCTCGGCCGGATCATCGACTTCTATACCAAGCGCTTCAAGGTCAAGCATGTGGTGCTGGTTGGTTATTCCTTTGGCGCCGATGTGCTGCCGGCGAGCTACAATCGCCTGCCTCAGGCCGAAAAGGACAAGATCGTCCAGATGTCGCTGCTGTCTTTGTCGCAGAAGGTCGACTATGTGATTTCGGTCATGGGCTGGCTCGGGGCCTCGAGCCAGGGCAAGGGCGGCGATCCCGTCAACGACCTCAAGTCGATCAATCCGAAGATGGTGCAATGCGTCTACGGCAAGGATGACGACGAGGATGTCGCCTGCCCGCTGCTGAAGGGCACGGGTGCGGAAGTCATCGCCATGGATGGCGGCCACCATTTCGATGACGATTACGAAGCCCTGGCGAACCACATCATCAATGGACTGAAGAGCCGCCTC
TRN  11011111101111111
NAM  Q53472_9ZZZZ/52-244
ASQ  KNTVAIIYSGDAGWQNIDEVIGTYLQTEGIPVIGVSSLRYFWSERSPSETAKDLGHIIDVYTKHFGVQNVLLIGYSFGADVMPASFNRLTLEQKNRVKQISLLALSHQVDYVVSFRGWLQLETEGKGGNPLDDLRFIDPAIVQCMYGREDRN-NACPSLRQTGAEVIGFSGGHHFGNDFKKLSTRVVSGLVARL
DSQ  AAGAACACGGTGGCGATCATTTATTCCGGAGACGCTGGATGGCAAAATATCGATGAGGTGATTGGTACCTATCTGCAGACGGAAGGGATTCCTGTCATTGGCGTCAGTTCACTTCGGTATTTCTGGTCGGAGCGGTCTCCAAGCGAAACTGCTAAGGATCTTGGTCACATAATCGATGTCTACACCAAGCATTTCGGTGTGCAGAATGTTTTACTTATAGGATATTCTTTCGGCGCTGACGTCATGCCGGCAAGCTTCAATAGGCTTACGCTTGAGCAAAAAAATCGGGTTAAGCAAATCTCTCTCTTGGCATTGTCACATCAAGTCGACTATGTCGTCTCATTTAGGGGCTGGCTCCAACTCGAAACCGAAGGTAAGGGCGGCAATCCTCTGGATGATCTCAGATTCATTGACCCTGCAATCGTCCAATGCATGTACGGGCGCGAAGACCGTAAT---AATGCTTGCCCATCTCTCCGACAGACCGGCGCAGAGGTGATAGGCTTCAGCGGAGGCCATCACTTTGGTAATGATTTCAAAAAACTGTCTACGCGCGTCGTCTCAGGCCTCGTGGCACGCCTA
TRN  10010101100011000
NAM  Q44405_9RHIZ/261-454
ASQ  MDTMAVIYSGDGGWRDLDEEVGSALQKQGVPVIGVDALRYFWKEKDPKEVAGDLARIIDTYRKEWKVKNVVLIGYSFGADIIPATYNLLPDRVKSSVAQFRCSAFPMKWILKSQFRDGLAWLVKARAARPSMTSPRSTPSWCNAFMAPRRKMKIPAPASRQRVSKPSASKAGTISTRITKALAKRIVTSLKTRL
DSQ  ATGGACACCATGGCGGTGATCTATTCCGGCGATGGCGGCTGGCGCGACCTGGACGAGGAAGTCGGCAGCGCCCTTCAGAAGCAGGGTGTGCCGGTCATTGGCGTCGATGCCCTGCGGTATTTCTGGAAGGAAAAGGATCCGAAAGAGGTGGCGGGCGATCTCGCCCGCATCATCGACACCTATCGCAAGGAATGGAAGGTCAAGAATGTCGTTCTGATCGGTTATTCCTTCGGTGCCGATATCATTCCCGCCACCTACAATCTCCTGCCCGACCGGGTGAAATCCTCCGTTGCGCAGTTTCGCTGCTCGGCCTTTCCAATGAAGTGGATTTTGAAATCTCAGTTCAGGGATGGCTTGGCGTGGCTGGTGAAGGCAAGGGCGGCAAGACCGTCGATGACATCGCCAAGATCGACCCCAAGCTGGTGCAATGCGTTTATGGCACCGAGGAGGAAGATGAAGATCCCTGCCCCGGCCTCAAGGCAAAGGGTGTCGAAACCATCGGCATCGAAGGCGGGCACCATTTCGACGAGGATTACGAAGGCGCTTGCCAAACGCATCGTCACCTCGCTGAAAACCAGGCTG
TRN  10010101100011001
NAM  Q9I538_PSEAE/232-422
ASQ  SDIVTLFYSGDGGWRDLDKDSAEHMASMGYPVVGIDTLRYYWQHKSPEQSAADLSKLMQHYREKWGAKRFVLAGYSFGADILPAIYNRLPGKDQQQVKAMLLLALARTGSFEIEVEGWLGKAGEEAATG--PEMARLPAAKVFCIYGAEEKD-ESGCTQSQAVGEKLELPGGHHFDEDYLSLAKKMLQAIRDRE
DSQ  TCGGACATCGTCACCCTGTTCTATTCCGGCGACGGCGGCTGGCGCGACCTGGACAAGGACTCTGCCGAGCATATGGCCAGCATGGGCTACCCGGTGGTCGGCATCGACACCCTGCGCTACTACTGGCAACACAAGAGCCCGGAACAGAGCGCCGCCGACCTCTCCAAGCTGATGCAACACTACCGCGAGAAGTGGGGCGCGAAACGTTTCGTCCTGGCCGGCTACTCGTTCGGCGCTGACATCCTGCCGGCGATCTACAACCGCCTGCCCGGAAAGGACCAGCAGCAAGTGAAAGCCATGCTGCTGCTGGCGCTGGCGCGGACCGGCAGCTTCGAGATCGAAGTGGAAGGCTGGCTGGGCAAGGCCGGCGAGGAAGCCGCCACCGGC------CCGGAAATGGCCAGGTTGCCGGCAGCCAAGGTGTTCTGCATCTATGGCGCCGAAGAAAAGGAC---GAAAGCGGCTGTACCCAATCCCAGGCCGTCGGCGAGAAGCTCGAACTGCCGGGCGGCCACCACTTCGACGAGGACTACCTGTCCCTGGCGAAGAAGATGCTCCAGGCCATCCGCGACCGCGAG
TRN  10010101100011011
NAM  Q8FW75_BRUSU/190-378
ASQ  ADMVAVFYSGDGGWRDIDKSIGEWLQAHGVHVIGVDSLRYFWSERTPEEIANDTTAMIKKADPT-GKLPVAVLGYSFGADTFPFAWKYLDPSIQDRTRMVGLLGVETTTTFQVSIEGWLGMNGDK---DVVPAIASIPLDRVVCVYGQEEDD-TACTADELKGMDTIKLPGGHHFDENYEPIAAALLDKMRSRA
DSQ  GCGGATATGGTCGCCGTGTTCTATTCCGGCGATGGTGGCTGGCGCGATATCGACAAATCCATTGGCGAATGGCTGCAAGCCCATGGGGTGCATGTGATCGGTGTGGATTCGCTGCGCTATTTCTGGTCCGAACGCACACCGGAGGAAATCGCCAACGACACAACCGCCATGATTAAAAAGGCAGATCCGACC---GGAAAGCTGCCCGTTGCCGTGCTTGGCTATTCTTTCGGTGCTGATACTTTCCCGTTCGCATGGAAATATCTCGATCCTTCCATTCAGGACCGCACTCGTATGGTGGGGCTGCTGGGCGTCGAAACCACCACGACCTTTCAGGTTTCCATTGAAGGCTGGCTCGGCATGAATGGCGACAAG---------GATGTGGTGCCGGCCATTGCGAGCATTCCGCTTGATCGCGTGGTCTGCGTTTACGGTCAGGAAGAAGACGAT---ACCGCCTGCACCGCCGATGAGTTGAAGGGAATGGATACCATAAAATTGCCCGGCGGCCACCATTTCGACGAGAATTATGAGCCGATTGCCGCAGCCCTTCTCGACAAGATGCGCAGCCGCGCC
TRN  10010101100011011
//