EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05992 - SbmA_BacA)
FAM  PF05992
PID  SbmA_BacA
DES  SbmA/BacA-like family
IPR  IPR009248
ANO  5
ALN  136
AID  0.519002
APH  (SBMA_ECOLI/34-169:0.43125,((Q986E2_RHILO/38-173:0.37828,Q8G2F1_BRUSU/38-173:0.24716):0.14119,BACA_RHIME/38-173:0.18321):0.14730,Q9AN93_BRAJA/2-120:0.50418);
ATP  (SBMA_ECOLI/34-169,((Q986E2_RHILO/38-173,Q8G2F1_BRUSU/38-173),BACA_RHIME/38-173),Q9AN93_BRAJA/2-120);
ATL  2.03257
DNO  5
DLN  408
DID  0.579377
DPH  (SBMA_ECOLI/34-169:15.23261,(Q9AN93_BRAJA/2-120:23.74248,(Q986E2_RHILO/38-173:16.41668,Q8G2F1_BRUSU/38-173:10.66831):5.19444):6.31103,BACA_RHIME/38-173:9.84364);
DTP  (SBMA_ECOLI/34-169,(Q9AN93_BRAJA/2-120,(Q986E2_RHILO/38-173,Q8G2F1_BRUSU/38-173)),BACA_RHIME/38-173);
DTL  87.417
RID  0.519002
RPH  (SBMA_ECOLI/34-169:0.43125,((Q986E2_RHILO/38-173:0.37828,Q8G2F1_BRUSU/38-173:0.24716):0.14119,BACA_RHIME/38-173:0.18321):0.14730,Q9AN93_BRAJA/2-120:0.50418);
RTP  (SBMA_ECOLI/34-169,((Q986E2_RHILO/38-173,Q8G2F1_BRUSU/38-173),BACA_RHIME/38-173),Q9AN93_BRAJA/2-120);
RTL  2.03257
LNK  BACA_RHIME/38-173:Q08120:AL591985
LNK  Q8G2F1_BRUSU/38-173:Q8G2F1:AE014291
LNK  Q986E2_RHILO/38-173:Q986E2:BA000012
LNK  Q9AN93_BRAJA/2-120:Q9AN93:AF322012
LNK  SBMA_ECOLI/34-169:P24212:X54153
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  SBMA_ECOLI/34-169
ASQ  WVARITGASGQIPISAARFWSLDFLIFYAYYIVCVGLFALFWFIYSPHRWQYWSILGTALIIFVTWFLVEVGVAVNAWYAPFYDLIQTALSSPHKVTIEQFYREVGVFLGIALIAVVISVLNNFFVSHYVFRWRTA
DSQ  TGGGTGGCGCGTATCACCGGCGCTTCCGGGCAGATCCCGATTAGCGCCGCGCGTTTCTGGTCGTTGGATTTCCTGATTTTTTACGCTTACTACATTGTTTGCGTAGGACTTTTTGCATTGTTCTGGTTTATCTACAGCCCGCATCGTTGGCAATACTGGTCAATACTCGGTACTGCACTGATCATCTTCGTCACCTGGTTTTTGGTGGAAGTCGGGGTCGCCGTCAACGCCTGGTATGCGCCGTTCTATGATCTGATTCAAACCGCGCTAAGTTCGCCGCATAAAGTCACCATCGAACAATTTTACCGCGAAGTGGGCGTCTTTCTGGGGATTGCGCTGATCGCTGTGGTGATCAGTGTGCTGAACAACTTCTTTGTCAGTCACTACGTGTTCCGCTGGCGTACAGCG
TRN  10010101100011001
NAM  Q8G2F1_BRUSU/38-173
ASQ  FGLAPAASDAAPLIGAHVFWSRPFLWFYIYFAVITFAFYGFWVRFSPHPWQRWSILGSALILFATYFNVQVSVAINTWYGPFYDMVQKGLTTPGAVSAAEFYWGLADFAGIAFLAITIGVLNLFFVSHYIFRWRTA
DSQ  TTCGGCCTTGCGCCAGCCGCAAGCGATGCCGCGCCTCTCATTGGCGCGCATGTGTTCTGGTCGCGGCCCTTCCTCTGGTTCTATATTTATTTCGCCGTCATTACCTTCGCCTTTTATGGCTTCTGGGTGCGTTTTTCCCCACATCCCTGGCAGAGATGGTCAATCCTCGGTTCTGCCCTCATTCTGTTCGCCACCTATTTCAACGTTCAGGTGAGTGTGGCAATCAATACTTGGTATGGCCCGTTCTACGATATGGTGCAGAAGGGGCTGACGACGCCCGGCGCGGTCTCGGCTGCGGAATTCTACTGGGGGCTGGCCGATTTTGCAGGCATTGCTTTCCTCGCCATCACCATTGGCGTGCTGAACCTCTTCTTCGTCAGCCATTATATCTTCCGCTGGCGCACGGCG
TRN  10010101100011001
NAM  BACA_RHIME/38-173
ASQ  LGLPPLPPGQEPVIGVSVFWSTPFLWFYIYYAVVAGLFAAFWFAYSPHRWQYWSVLGTALIIFNTYFSVQVSVAINAWYGPFYDLIQQALARTAPVTAGQLYSGMIGFSGIAFVAVTVGVLNLFFVSHYIFRWRTA
DSQ  CTGGGCTTGCCGCCGCTTCCTCCAGGACAGGAACCCGTCATCGGCGTGTCCGTTTTCTGGTCCACCCCTTTTCTTTGGTTTTACATCTATTATGCGGTGGTCGCAGGGCTATTCGCAGCGTTCTGGTTCGCCTACAGCCCGCATCGGTGGCAGTATTGGTCGGTACTCGGCACGGCGCTGATCATTTTCAATACCTATTTTTCGGTTCAGGTCAGCGTCGCGATCAACGCGTGGTACGGCCCTTTCTATGATTTGATCCAGCAGGCGCTGGCGCGTACGGCGCCGGTCACAGCAGGGCAGCTCTATTCGGGAATGATCGGATTTTCGGGAATAGCCTTCGTGGCGGTGACGGTCGGTGTGCTCAACCTCTTTTTCGTCAGCCATTACATCTTTCGCTGGCGCACGGCG
TRN  10010111100111011
NAM  Q986E2_RHILO/38-173
ASQ  FGLPAAAADAPPIIGIAVLVSKPFLWFYIYFVACVAIFYAFWSWYSPHPWQRWSILMTAVILFFIYFNVQVSVAVNAWYGPFFDYVQGLMSGTGKSTNGEFYTGLADFSWLALVGMNVQVVNAFIVSHWIFRWRTA
DSQ  TTCGGCCTGCCAGCCGCCGCCGCTGACGCTCCGCCCATCATCGGCATCGCTGTTCTCGTGTCGAAGCCGTTCCTCTGGTTCTACATCTATTTCGTGGCCTGCGTGGCCATCTTCTACGCATTCTGGAGCTGGTATTCGCCGCATCCGTGGCAGCGCTGGTCGATCCTGATGACGGCGGTTATCCTGTTCTTCATCTATTTCAATGTGCAGGTCAGCGTCGCCGTCAACGCCTGGTACGGGCCCTTCTTCGACTATGTGCAGGGGCTGATGTCAGGGACCGGAAAATCGACCAACGGTGAATTTTATACCGGGCTGGCCGACTTTTCCTGGCTCGCGCTGGTCGGCATGAATGTGCAGGTGGTCAATGCCTTTATCGTCAGCCATTGGATCTTCCGCTGGCGCACGGCG
TRN  11011101101011001
NAM  Q9AN93_BRAJA/2-120
ASQ  ASRAICSKRRKRQVGLATFSSAPALWFDLYFAACAAIFAAGWMLVAPHPWATWSILGSALILFTSYFQVQVSVAINSWYGPFYDLVQAALSKSAQVMVQQFYSELSTFAGIALVAVV-----------------SV
DSQ  GCTTCGCGAGCAATCTGTTCGAAGCGCCGCAAAAGGCAGGTCGGGTTGGCGACGTTCTCGTCGGCGCCGGCTCTCTGGTTCGACCTCTATTTCGCCGCGTGCGCCGCGATATTTGCGGCTGGCTGGATGTTGGTTGCGCCGCACCCCTGGGCGACGTGGTCGATTCTTGGCTCCGCGCTAATACTGTTCACCTCCTACTTTCAGGTCCAGGTCAGCGTCGCCATCAACAGCTGGTATGGGCCATTCTATGACCTTGTCCAGGCCGCGCTTTCGAAATCGGCGCAAGTGATGGTCCAGCAGTTCTACAGCGAGTTGTCGACTTTTGCCGGCATTGCTCTTGTTGCGGTCGTG---------------------------------------------------TCGGTG
TRN  10010101100011011
//