EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05862 - IceA2)
FAM  PF05862
PID  IceA2
DES  Helicobacter pylori IceA2 protein
IPR  IPR008655
ANO  3
ALN  94
AID  0.751787
APH  (Q9ZIW8_HELPY/1-94:0.13131,Q8VTH2_HELPY/1-59:0.11464,Q9F9S3_HELPY/1-59:0.21256);
ATP  (Q9ZIW8_HELPY/1-94,Q8VTH2_HELPY/1-59,Q9F9S3_HELPY/1-59);
ATL  0.45851
DNO  3
DLN  282
DID  0.84829
DPH  (Q9ZIW8_HELPY/1-94:0.06356,Q8VTH2_HELPY/1-59:0.03639,Q9F9S3_HELPY/1-59:0.14525);
DTP  (Q9ZIW8_HELPY/1-94,Q8VTH2_HELPY/1-59,Q9F9S3_HELPY/1-59);
DTL  0.2452
RID  0.751787
RPH  (Q9ZIW8_HELPY/1-94:0.13131,Q8VTH2_HELPY/1-59:0.11464,Q9F9S3_HELPY/1-59:0.21256);
RTP  (Q9ZIW8_HELPY/1-94,Q8VTH2_HELPY/1-59,Q9F9S3_HELPY/1-59);
RTL  0.45851
LNK  Q8VTH2_HELPY/1-59:Q8VTH2:AF326604
LNK  Q9F9S3_HELPY/1-59:Q9F9S3:AF176823
LNK  Q9ZIW8_HELPY/1-94:Q9ZIW8:AF008929
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9ZIW8_HELPY/1-94
ASQ  MAVVVKIVNGKIQEFENGSHKRTYGSNIVAADTDGHIVAAVTTKGKIEEYENGHCRRIYGSNAVNVQVSGGIVAVTTSKGKVEEYENGHCRRIY
DSQ  ATGGCGGTTGTAGTTAAAATCGTTAATGGCAAAATACAGGAATTTGAGAATGGTAGCCATAAAAGAACTTATGGTAGTAATATTGTAGCTGCAGATACTGATGGGCATATTGTTGCTGCTGTTACCACAAAGGGTAAGATAGAAGAATATGAGAATGGTCATTGTAGAAGAATTTATGGTAGCAACGCTGTTAATGTGCAAGTTTCAGGCGGTATAGTGGCTGTAACCACATCAAAGGGTAAAGTGGAAGAATATGAGAATGGTCATTGTAGAAGAATCTAC
TRN  10010101110011001
NAM  Q8VTH2_HELPY/1-59
ASQ  MAVAIKVVNGKIQEYENGNYKRTYGSNIVAADTDGHIVAAVTA-----------------------------------KSKVEEYKNGIHKRTY
DSQ  ATGGCGGTTGCAATTAAAGTCGTTAATGGCAAAATACAGGAATATGAGAATGGTAACTATAAGAGAACTTATGGTAGTAATATCGTAGCTGCAGATACTGATGGGCATATTGTTGCTGCTGTTACTGCA---------------------------------------------------------------------------------------------------------AAGAGTAAAGTGGAAGAATATAAGAATGGTATTCATAAAAGAACCTAC
TRN  10010101110011011
NAM  Q9F9S3_HELPY/1-59
ASQ  MAVVIKVVNGKIQEYENGIHKRTYGSN-----------------------------------AINVQVSGGVVAVTTSKGKVEEYRMVFIKEAT
DSQ  ATGGCGGTTGTAATTAAAGTCGTTAATGGCAAAATACAGGAATATGAGAATGGTATCCATAAGAGAACTTATGGTAGTAAC---------------------------------------------------------------------------------------------------------GCTATTAATGTGCAAGTTTCAGGTGGTGTAGTGGCTGTAACCACATCAAAGGGTAAAGTGGAAGAATATAGAATGGTATTCATAAAAGAAGCTACT
TRN  10010101110011001
//