EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05627 - NOI)
FAM  PF05627
PID  NOI
DES  Nitrate-induced NOI protein
IPR  IPR008700
ANO  7
ALN  89
AID  0.622609
APH  (((((O22634_ORYSA/1-75:0.21515,O22633_ARATH/1-72:0.34726):0.08909,Q8LGF0_ARATH/6-73:0.48902):0.01901,O22632_MAIZE/1-73:0.24410):0.13892,Q9SEY4_ARATH/1-67:0.29419):0.29787,Q8LCF4_ARATH/1-89:0.36669,Q9FMJ6_ARATH/1-80:0.11737);
ATP  (((((O22634_ORYSA/1-75,O22633_ARATH/1-72),Q8LGF0_ARATH/6-73),O22632_MAIZE/1-73),Q9SEY4_ARATH/1-67),Q8LCF4_ARATH/1-89,Q9FMJ6_ARATH/1-80);
ATL  2.61124
DNO  7
DLN  267
DID  0.628671
DPH  (((Q8LGF0_ARATH/6-73:0.39668,(O22633_ARATH/1-72:0.21646,(O22634_ORYSA/1-75:0.19613,O22632_MAIZE/1-73:0.23917):0.12259):0.04074):0.07691,Q9SEY4_ARATH/1-67:0.30488):0.17805,Q8LCF4_ARATH/1-89:0.24022,Q9FMJ6_ARATH/1-80:0.08009);
DTP  (((Q8LGF0_ARATH/6-73,(O22633_ARATH/1-72,(O22634_ORYSA/1-75,O22632_MAIZE/1-73))),Q9SEY4_ARATH/1-67),Q8LCF4_ARATH/1-89,Q9FMJ6_ARATH/1-80);
DTL  2.08475
RID  0.622609
RPH  (((((O22634_ORYSA/1-75:0.21515,O22633_ARATH/1-72:0.34726):0.08909,Q8LGF0_ARATH/6-73:0.48902):0.01901,O22632_MAIZE/1-73:0.24410):0.13892,Q9SEY4_ARATH/1-67:0.29419):0.29787,Q8LCF4_ARATH/1-89:0.36669,Q9FMJ6_ARATH/1-80:0.11737);
RTP  (((((O22634_ORYSA/1-75,O22633_ARATH/1-72),Q8LGF0_ARATH/6-73),O22632_MAIZE/1-73),Q9SEY4_ARATH/1-67),Q8LCF4_ARATH/1-89,Q9FMJ6_ARATH/1-80);
RTL  2.61124
LNK  O22632_MAIZE/1-73:O22632:AF030385
LNK  O22633_ARATH/1-72:O22633:AF030386
LNK  O22634_ORYSA/1-75:O22634:AF030387
LNK  Q8LCF4_ARATH/1-89:Q8LCF4:AY086630
LNK  Q8LGF0_ARATH/6-73:Q8LGF0:AY084310
LNK  Q9FMJ6_ARATH/1-80:Q9FMJ6:AB008265
LNK  Q9SEY4_ARATH/1-67:Q9SEY4:AF324986
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9SEY4_ARATH/1-67
ASQ  MASNEAGRALPKFGEWDVNDPATADGFTVIFSKAGEDKKTGRSS-----TKTNSQRKQDGDKP-----------------AVKKWLCFT
DSQ  ATGGCGTCGAATGAAGCTGGAAGGGCATTGCCGAAATTCGGGGAATGGGATGTGAATGATCCAGCGACGGCGGATGGATTCACGGTGATATTCAGCAAAGCCGGTGAAGATAAAAAGACGGGACGGAGTTCG---------------ACGAAGACGAATTCACAGAGGAAACAAGATGGTGATAAACCA---------------------------------------------------GCGGTCAAGAAATGGCTCTGTTTCACT
TRN  10010101110011001
NAM  O22632_MAIZE/1-73
ASQ  MA-EESGRPLPKFGEWDVNDPASADGFTVIFNKARDEKKGGNG--------------QDTDSPSKDPRTERVESYAAKP-STKKWFCCV
DSQ  ATGGCG---GAGGAATCAGGCCGTCCCTTGCCAAAGTTTGGTGAATGGGATGTCAACGATCCGGCTTCCGCAGACGGATTTACTGTCATATTCAACAAAGCCAGAGATGAGAAGAAGGGTGGGAATGGT------------------------------------------CAAGACACAGACTCACCTTCCAAGGACCCCAGGACTGAGAGGGTGGAGTCTTATGCTGCAAAACCA---AGCACGAAGAAATGGTTTTGTTGTGTG
TRN  10010101110011001
NAM  O22634_ORYSA/1-75
ASQ  MA-AEKGSPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGGNS-------------QGQDLAAKSEQPSGQGLYPAKPNSSKKWFCCM
DSQ  ATGGCG---GCGGAAAAAGGAAGTCCGTTGCCGAAGTTTGGGGAATGGGATGTCAATGATCCTGCTTCAGCTGAGGGATTCACTGTAATCTTTAACAAAGCTAGAGACGAGAAGAAGACTGGTGGCAATTCA---------------------------------------CAGGGACAAGATTTGGCCGCAAAAAGTGAACAGCCATCTGGACAAGGGTTGTATCCAGCAAAACCGAACAGTTCCAAGAAATGGTTCTGCTGCATG
TRN  10110101110011001
NAM  Q8LGF0_ARATH/6-73
ASQ  QQRQQQDRPLPKFGEWDVNDPASAEGFTVIFAKARDDKKTNASG-------RAASQRRDNNKSQDE--------------PTKKRFCCF
DSQ  CAACAACGACAACAACAAGATCGACCATTACCAAAATTTGGAGAATGGGATGTGAACGATCCAGCATCAGCTGAAGGATTTACGGTTATATTCGCTAAAGCTCGAGACGACAAAAAGACAAACGCAAGTGGT---------------------CGTGCCGCCTCACAACGCCGTGACAATAACAAATCTCAAGATGAA------------------------------------------CCTACGAAGAAACGGTTCTGCTGTTTC
TRN  10010101110011000
NAM  O22633_ARATH/1-72
ASQ  MS--DKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGGKP-------------GSPGKSSEG-HVKSGGGDPSKP-QPKKWLCCM
DSQ  ATGTCG------GACAAAGGTCGTCCCTTGCCAAAATTTGGTGAATGGGATGTGAATGATCCAGCATCAGCAGAAGGTTTTACAGTGATATTCAACAAAGCTAGGGATGAGAAAAAGACCGGTGGCAAACCG---------------------------------------GGATCACCCGGTAAATCCAGTGAGGGT---CATGTTAAATCTGGAGGAGGAGATCCTAGTAAACCT---CAGCCTAAAAAATGGCTTTGCTGCATG
TRN  10010101110011001
NAM  Q9FMJ6_ARATH/1-80
ASQ  MA-ENKGKPLPKFGEWDVNNPASAEGFTVIFSKASDEKKTKKASGAGPNSLVSPQRNQNSDQNNNH--------SSQNPKAKNKWFCFR
DSQ  ATGGCG---GAAAACAAAGGGAAACCATTGCCAAAGTTTGGGGAATGGGATGTGAACAATCCGGCATCAGCCGAAGGATTCACAGTCATTTTCAGCAAAGCTAGTGACGAGAAGAAGACCAAGAAAGCATCCGGCGCTGGCCCTAATAGTCTGGTTTCACCTCAGAGAAACCAAAACTCCGATCAAAACAATAACCAT------------------------AGTTCCCAAAACCCTAAAGCTAAGAACAAATGGTTTTGCTTCCGT
TRN  10010101100011001
NAM  Q8LCF4_ARATH/1-89
ASQ  MATGNRARPLPKFGEWDATNPGSAEGFTVIFNKARDDKKTMKTAVAGPESIVSPPRNEEPPKNNNNHHHNHHTRHSQTPRSKKKWLCFR
DSQ  ATGGCAACGGGAAATAGAGCGAGACCATTGCCAAAATTTGGGGAATGGGATGCGACTAATCCTGGCTCGGCTGAAGGATTCACTGTCATTTTCAATAAAGCTCGCGATGACAAGAAGACGATGAAAACCGCTGTCGCAGGACCTGAGAGTATTGTTTCACCTCCAAGAAATGAAGAACCTCCTAAAAACAACAACAACCATCATCACAACCATCACACCCGTCATTCCCAAACCCCAAGATCAAAGAAGAAATGGCTTTGTTTTCGT
TRN  10010101110011001
//