EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05524 - PEP-utilisers_N)
FAM  PF05524
PID  PEP-utilisers_N
DES  PEP-utilising enzyme, N-terminal
IPR  IPR008731
ANO  46
ALN  128
AID  0.304705
APH  (((PT1_STAAN/5-129:0.24188,(PT1_LISIN/5-128:0.13027,((PT1_LACLC/5-129:0.16440,Q99Z66_STRPY/5-129:0.15849):0.12364,(Q9KJV2_LACCA/5-129:0.13654,PT1_LACSK/4-128:0.22780):0.15566):0.23866):0.09231):0.10015,(PT1_BACME/5-128:0.13767,(PT1_BACSI/10-133:0.19216,PT1_BACSU/4-127:0.19170):0.08843):0.08702):0.07063,PT1_BACHD/5-128:0.31190,(((((((((Q8YJ96_BRUME/183-304:0.11578,Q8U8B9_AGRT5/183-304:0.19219):1.33926,PT1_STRCO/5-124:0.86625):0.21517,Q8VP40_ECOLI/10-125:0.94860):0.22000,((DHAM_ECOLI/251-370:0.77024,Q98C54_RHILO/6-122:1.21718):0.11516,((Q9HY55_PSEAE/403-521:0.85371,((Q8XQE5_RALSO/296-416:0.80097,Q9HXN5_PSEAE/283-404:0.66506):0.27994,Q9AAZ4_CAUCR/290-407:0.53646):0.12863):0.05225,PTF1_RHOCA/274-395:0.75559):0.36262):0.08459):0.13587,(((Q8P705_XANCP/5-130:0.14214,Q9PDH7_XYLFA/20-143:0.49644):0.54164,(Q9JWF8_NEIMA/5-130:0.48103,PT1_ALCEU/5-130:0.42992):0.18443):0.38918,((Q9KU52_VIBCH/171-295:0.40606,(Q8Z411_SALTI/171-295:0.22704,Q8ZHU9_YERPE/171-295:0.09741):0.40137):0.54335,(Q9X4P3_PSEAE/178-302:0.32806,Q9RNG5_LEGPN/185-310:0.49018):0.37529):0.18963):0.20626):0.30687,((((PT1_BORBU/3-129:1.06135,(((PT1_BUCAI/2-127:0.08557,PT1_BUCAP/2-127:0.21531):0.28347,PT1_SALTY/2-127:0.06225):0.14517,Q9KTD7_VIBCH/2-127:0.10689):0.10167):0.06512,Q9CMD3_PASMU/2-127:0.41024):0.19978,Q8RI43_FUSNN/11-134:0.39965):0.11287,Q8R7R4_THETN/2-127:0.39722):0.05631):0.08650,(((PT1_MYCPN/4-128:0.18169,PT1_MYCGE/4-128:0.14690):0.77081,PT1_MYCCA/5-128:0.26739):0.20636,(Q9RGC5_MYCHY/9-130:0.68275,Q98PW7_MYCPU/3-123:0.49144):0.14233):0.20819):0.05561,Q93TM5_LACBR/2-126:0.80435):0.08256,(Q97EM3_CLOAB/3-126:0.36032,Q8XHW9_CLOPE/2-125:0.40940):0.29431):0.14754);
ATP  (((PT1_STAAN/5-129,(PT1_LISIN/5-128,((PT1_LACLC/5-129,Q99Z66_STRPY/5-129),(Q9KJV2_LACCA/5-129,PT1_LACSK/4-128)))),(PT1_BACME/5-128,(PT1_BACSI/10-133,PT1_BACSU/4-127))),PT1_BACHD/5-128,(((((((((Q8YJ96_BRUME/183-304,Q8U8B9_AGRT5/183-304),PT1_STRCO/5-124),Q8VP40_ECOLI/10-125),((DHAM_ECOLI/251-370,Q98C54_RHILO/6-122),((Q9HY55_PSEAE/403-521,((Q8XQE5_RALSO/296-416,Q9HXN5_PSEAE/283-404),Q9AAZ4_CAUCR/290-407)),PTF1_RHOCA/274-395))),(((Q8P705_XANCP/5-130,Q9PDH7_XYLFA/20-143),(Q9JWF8_NEIMA/5-130,PT1_ALCEU/5-130)),((Q9KU52_VIBCH/171-295,(Q8Z411_SALTI/171-295,Q8ZHU9_YERPE/171-295)),(Q9X4P3_PSEAE/178-302,Q9RNG5_LEGPN/185-310)))),((((PT1_BORBU/3-129,(((PT1_BUCAI/2-127,PT1_BUCAP/2-127),PT1_SALTY/2-127),Q9KTD7_VIBCH/2-127)),Q9CMD3_PASMU/2-127),Q8RI43_FUSNN/11-134),Q8R7R4_THETN/2-127)),(((PT1_MYCPN/4-128,PT1_MYCGE/4-128),PT1_MYCCA/5-128),(Q9RGC5_MYCHY/9-130,Q98PW7_MYCPU/3-123))),Q93TM5_LACBR/2-126),(Q97EM3_CLOAB/3-126,Q8XHW9_CLOPE/2-125)));
ATL  28.7825
DNO  46
DLN  384
DID  0.433075
DPH  (((((((((((PT1_BACME/5-128:0.15488,(PT1_BACSI/10-133:0.30347,PT1_BACSU/4-127:0.18142):0.08581):0.04904,((((((Q9CMD3_PASMU/2-127:0.32351,(((PT1_BUCAI/2-127:0.09588,PT1_BUCAP/2-127:0.12802):0.20501,PT1_SALTY/2-127:0.15593):0.08869,Q9KTD7_VIBCH/2-127:0.15521):0.09867):0.13446,Q8RI43_FUSNN/11-134:0.29854):0.07197,(Q8R7R4_THETN/2-127:0.31656,(Q97EM3_CLOAB/3-126:0.25536,Q8XHW9_CLOPE/2-125:0.31672):0.08673):0.04475):0.04839,(((PT1_BORBU/3-129:0.50088,Q9RGC5_MYCHY/9-130:0.41344):0.04178,Q98PW7_MYCPU/3-123:0.25380):0.05237,PT1_MYCCA/5-128:0.28468):0.08758):0.04870,(PT1_MYCPN/4-128:0.34230,PT1_MYCGE/4-128:0.03288):0.43012):0.10732,(((PT1_LACLC/5-129:0.17910,Q99Z66_STRPY/5-129:0.18465):0.12820,(Q9KJV2_LACCA/5-129:0.21787,PT1_LACSK/4-128:0.23124):0.11821):0.09199,(PT1_LISIN/5-128:0.20707,PT1_STAAN/5-129:0.23814):0.05476):0.06870):0.05557):0.07818,PT1_BACHD/5-128:0.27106):0.20523,Q93TM5_LACBR/2-126:0.46198):0.16951,DHAM_ECOLI/251-370:0.53023):0.10276,Q8VP40_ECOLI/10-125:0.71646):0.12296,Q98C54_RHILO/6-122:0.60876):0.12054,(Q9KU52_VIBCH/171-295:0.29560,(Q8Z411_SALTI/171-295:0.22963,Q8ZHU9_YERPE/171-295:0.23713):0.23619):0.26830):0.10965,(((Q8P705_XANCP/5-130:0.13339,Q9PDH7_XYLFA/20-143:0.35205):0.20903,(Q9JWF8_NEIMA/5-130:0.39101,PT1_ALCEU/5-130:0.21112):0.10924):0.11707,(PT1_STRCO/5-124:0.47409,((PTF1_RHOCA/274-395:0.37639,((Q8XQE5_RALSO/296-416:0.41317,Q9HXN5_PSEAE/283-404:0.32766):0.10381,Q9AAZ4_CAUCR/290-407:0.28482):0.06233):0.07202,Q9HY55_PSEAE/403-521:0.37855):0.12362):0.07647):0.02666):0.09924,(Q9X4P3_PSEAE/178-302:0.23125,Q9RNG5_LEGPN/185-310:0.57374):0.13067):0.47037,Q8YJ96_BRUME/183-304:0.19697,Q8U8B9_AGRT5/183-304:0.10712);
DTP  (((((((((((PT1_BACME/5-128,(PT1_BACSI/10-133,PT1_BACSU/4-127)),((((((Q9CMD3_PASMU/2-127,(((PT1_BUCAI/2-127,PT1_BUCAP/2-127),PT1_SALTY/2-127),Q9KTD7_VIBCH/2-127)),Q8RI43_FUSNN/11-134),(Q8R7R4_THETN/2-127,(Q97EM3_CLOAB/3-126,Q8XHW9_CLOPE/2-125))),(((PT1_BORBU/3-129,Q9RGC5_MYCHY/9-130),Q98PW7_MYCPU/3-123),PT1_MYCCA/5-128)),(PT1_MYCPN/4-128,PT1_MYCGE/4-128)),(((PT1_LACLC/5-129,Q99Z66_STRPY/5-129),(Q9KJV2_LACCA/5-129,PT1_LACSK/4-128)),(PT1_LISIN/5-128,PT1_STAAN/5-129)))),PT1_BACHD/5-128),Q93TM5_LACBR/2-126),DHAM_ECOLI/251-370),Q8VP40_ECOLI/10-125),Q98C54_RHILO/6-122),(Q9KU52_VIBCH/171-295,(Q8Z411_SALTI/171-295,Q8ZHU9_YERPE/171-295))),(((Q8P705_XANCP/5-130,Q9PDH7_XYLFA/20-143),(Q9JWF8_NEIMA/5-130,PT1_ALCEU/5-130)),(PT1_STRCO/5-124,((PTF1_RHOCA/274-395,((Q8XQE5_RALSO/296-416,Q9HXN5_PSEAE/283-404),Q9AAZ4_CAUCR/290-407)),Q9HY55_PSEAE/403-521)))),(Q9X4P3_PSEAE/178-302,Q9RNG5_LEGPN/185-310)),Q8YJ96_BRUME/183-304,Q8U8B9_AGRT5/183-304);
DTL  18.8055
RID  0.304705
RPH  (((PT1_STAAN/5-129:0.24188,(PT1_LISIN/5-128:0.13027,((PT1_LACLC/5-129:0.16440,Q99Z66_STRPY/5-129:0.15849):0.12364,(Q9KJV2_LACCA/5-129:0.13654,PT1_LACSK/4-128:0.22780):0.15566):0.23866):0.09231):0.10015,(PT1_BACME/5-128:0.13767,(PT1_BACSI/10-133:0.19216,PT1_BACSU/4-127:0.19170):0.08843):0.08702):0.07063,PT1_BACHD/5-128:0.31190,(((((((((Q8YJ96_BRUME/183-304:0.11578,Q8U8B9_AGRT5/183-304:0.19219):1.33926,PT1_STRCO/5-124:0.86625):0.21517,Q8VP40_ECOLI/10-125:0.94860):0.22000,((DHAM_ECOLI/251-370:0.77024,Q98C54_RHILO/6-122:1.21718):0.11516,((Q9HY55_PSEAE/403-521:0.85371,((Q8XQE5_RALSO/296-416:0.80097,Q9HXN5_PSEAE/283-404:0.66506):0.27994,Q9AAZ4_CAUCR/290-407:0.53646):0.12863):0.05225,PTF1_RHOCA/274-395:0.75559):0.36262):0.08459):0.13587,(((Q8P705_XANCP/5-130:0.14214,Q9PDH7_XYLFA/20-143:0.49644):0.54164,(Q9JWF8_NEIMA/5-130:0.48103,PT1_ALCEU/5-130:0.42992):0.18443):0.38918,((Q9KU52_VIBCH/171-295:0.40606,(Q8Z411_SALTI/171-295:0.22704,Q8ZHU9_YERPE/171-295:0.09741):0.40137):0.54335,(Q9X4P3_PSEAE/178-302:0.32806,Q9RNG5_LEGPN/185-310:0.49018):0.37529):0.18963):0.20626):0.30687,((((PT1_BORBU/3-129:1.06135,(((PT1_BUCAI/2-127:0.08557,PT1_BUCAP/2-127:0.21531):0.28347,PT1_SALTY/2-127:0.06225):0.14517,Q9KTD7_VIBCH/2-127:0.10689):0.10167):0.06512,Q9CMD3_PASMU/2-127:0.41024):0.19978,Q8RI43_FUSNN/11-134:0.39965):0.11287,Q8R7R4_THETN/2-127:0.39722):0.05631):0.08650,(((PT1_MYCPN/4-128:0.18169,PT1_MYCGE/4-128:0.14690):0.77081,PT1_MYCCA/5-128:0.26739):0.20636,(Q9RGC5_MYCHY/9-130:0.68275,Q98PW7_MYCPU/3-123:0.49144):0.14233):0.20819):0.05561,Q93TM5_LACBR/2-126:0.80435):0.08256,(Q97EM3_CLOAB/3-126:0.36032,Q8XHW9_CLOPE/2-125:0.40940):0.29431):0.14754);
RTP  (((PT1_STAAN/5-129,(PT1_LISIN/5-128,((PT1_LACLC/5-129,Q99Z66_STRPY/5-129),(Q9KJV2_LACCA/5-129,PT1_LACSK/4-128)))),(PT1_BACME/5-128,(PT1_BACSI/10-133,PT1_BACSU/4-127))),PT1_BACHD/5-128,(((((((((Q8YJ96_BRUME/183-304,Q8U8B9_AGRT5/183-304),PT1_STRCO/5-124),Q8VP40_ECOLI/10-125),((DHAM_ECOLI/251-370,Q98C54_RHILO/6-122),((Q9HY55_PSEAE/403-521,((Q8XQE5_RALSO/296-416,Q9HXN5_PSEAE/283-404),Q9AAZ4_CAUCR/290-407)),PTF1_RHOCA/274-395))),(((Q8P705_XANCP/5-130,Q9PDH7_XYLFA/20-143),(Q9JWF8_NEIMA/5-130,PT1_ALCEU/5-130)),((Q9KU52_VIBCH/171-295,(Q8Z411_SALTI/171-295,Q8ZHU9_YERPE/171-295)),(Q9X4P3_PSEAE/178-302,Q9RNG5_LEGPN/185-310)))),((((PT1_BORBU/3-129,(((PT1_BUCAI/2-127,PT1_BUCAP/2-127),PT1_SALTY/2-127),Q9KTD7_VIBCH/2-127)),Q9CMD3_PASMU/2-127),Q8RI43_FUSNN/11-134),Q8R7R4_THETN/2-127)),(((PT1_MYCPN/4-128,PT1_MYCGE/4-128),PT1_MYCCA/5-128),(Q9RGC5_MYCHY/9-130,Q98PW7_MYCPU/3-123))),Q93TM5_LACBR/2-126),(Q97EM3_CLOAB/3-126,Q8XHW9_CLOPE/2-125)));
RTL  28.7825
LNK  DHAM_ECOLI/251-370:P37349:U00096
LNK  PT1_ALCEU/5-130:P23536:M69036
LNK  PT1_BACHD/5-128:Q9K8D3:AP001517
LNK  PT1_BACME/5-128:O69251:AJ005075
LNK  PT1_BACSI/10-133:O83018:AB016285
LNK  PT1_BACSU/4-127:P08838:M98359
LNK  PT1_BORBU/3-129:O51508:AE001157
LNK  PT1_BUCAI/2-127:Q9WXI6:AP001118
LNK  PT1_BUCAP/2-127:Q8KA50:AE014081
LNK  PT1_LACLC/5-129:Q9ZAD8:Z97203
LNK  PT1_LACSK/4-128:O07126:U82366
LNK  PT1_LISIN/5-128:Q92D19:AL596167
LNK  PT1_MYCCA/5-128:P45617:U15110
LNK  PT1_MYCGE/4-128:P47668:U39725
LNK  PT1_MYCPN/4-128:P75168:AE000021
LNK  PT1_SALTY/2-127:P12654:M76176
LNK  PT1_STAAN/5-129:Q99V14:AP003132
LNK  PT1_STRCO/5-124:Q9KZP1:AL939108
LNK  PTF1_RHOCA/274-395:P23388:X53150
LNK  Q8P705_XANCP/5-130:Q8P705:AE012393
LNK  Q8R7R4_THETN/2-127:Q8R7R4:AE013175
LNK  Q8RI43_FUSNN/11-134:Q8RI43:AE010481
LNK  Q8U8B9_AGRT5/183-304:Q8U8B9:AE009347
LNK  Q8VP40_ECOLI/10-125:Q8VP40:AF289032
LNK  Q8XHW9_CLOPE/2-125:Q8XHW9:BA000016
LNK  Q8XQE5_RALSO/296-416:Q8XQE5:AL646084
LNK  Q8YJ96_BRUME/183-304:Q8YJ96:AE009461
LNK  Q8Z411_SALTI/171-295:Q8Z411:AL627277
LNK  Q8ZHU9_YERPE/171-295:Q8ZHU9:AJ414144
LNK  Q93TM5_LACBR/2-126:Q93TM5:AF343444
LNK  Q97EM3_CLOAB/3-126:Q97EM3:AE007805
LNK  Q98C54_RHILO/6-122:Q98C54:BA000012
LNK  Q98PW7_MYCPU/3-123:Q98PW7:AL445565
LNK  Q99Z66_STRPY/5-129:Q99Z66:AE006575
LNK  Q9AAZ4_CAUCR/290-407:Q9AAZ4:AE005718
LNK  Q9CMD3_PASMU/2-127:Q9CMD3:AE006128
LNK  Q9HXN5_PSEAE/283-404:Q9HXN5:AE004794
LNK  Q9HY55_PSEAE/403-521:Q9HY55:AE004777
LNK  Q9JWF8_NEIMA/5-130:Q9JWF8:AL162753
LNK  Q9KJV2_LACCA/5-129:Q9KJV2:AF159589
LNK  Q9KTD7_VIBCH/2-127:Q9KTD7:AE004178
LNK  Q9KU52_VIBCH/171-295:Q9KU52:AE004153
LNK  Q9PDH7_XYLFA/20-143:Q9PDH7:AE003971
LNK  Q9RGC5_MYCHY/9-130:Q9RGC5:AF140575
LNK  Q9RNG5_LEGPN/185-310:Q9RNG5:AF181870
LNK  Q9X4P3_PSEAE/178-302:Q9X4P3:AF116285
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9HXN5_PSEAE/283-404
ASQ  LAGVCASPGLASGPLARLGAISLPADDGR.---HRPEEQHLALDQALQRVRDDVQGSLQQARLGGDENEAAIFSAHLALLEDPGLLDAADMLIDQGV-GAAHAWHRAIQAQCEILQAL.GNLLLAERA
DSQ  CTGGCCGGCGTCTGCGCTTCGCCCGGCCTGGCCAGCGGTCCCCTGGCGCGGCTCGGCGCCATCAGCCTGCCGGCGGATGACGGCCGG...---------CATCGTCCCGAGGAACAGCACCTCGCCCTGGACCAGGCCCTGCAACGGGTGCGCGACGACGTACAGGGGAGCCTGCAGCAGGCCAGGCTCGGCGGCGACGAGAACGAAGCGGCGATCTTTTCCGCGCATCTCGCGCTGCTGGAAGACCCGGGTCTGCTGGACGCCGCCGACATGCTGATCGACCAGGGCGTC---GGCGCCGCCCACGCCTGGCACCGGGCGATCCAGGCCCAGTGCGAGATTCTCCAGGCGCTG...GGCAACCTGCTGCTGGCCGAGCGCGCC
TRN  10010101100011011
NAM  Q9AAZ4_CAUCR/290-407
ASQ  LKGVPAAPGLAIGKAVRLSTAEIVVREAG.---EGVAHEEAALAVALETVRARI----GKAAETGDKARKAILAAHQAFLDDPELYAGAHRLIAEGK-SAGFAWRRAVGGYVQALQAL.GDRRMAERV
DSQ  CTGAAGGGCGTGCCGGCCGCGCCGGGCCTGGCCATCGGCAAGGCCGTGCGGCTGTCGACCGCCGAGATCGTCGTGCGCGAGGCCGGC...---------GAGGGCGTCGCCCACGAGGAAGCGGCCCTGGCCGTAGCCCTGGAGACGGTCCGCGCCCGGATC------------GGCAAGGCCGCCGAGACCGGCGACAAGGCCCGCAAGGCGATCCTGGCGGCCCACCAGGCGTTCCTCGACGACCCCGAACTCTACGCCGGCGCCCATCGCCTGATCGCTGAGGGCAAG---AGCGCAGGCTTTGCCTGGCGCCGGGCCGTGGGCGGCTATGTCCAGGCGCTGCAGGCGCTG...GGCGATCGCCGCATGGCCGAACGGGTC
TRN  11011111101111111
NAM  Q8XQE5_RALSO/296-416
ASQ  LRGVGASPGVAVGQIVRWSGIAPEFDETG.---GPFEQEHARLHAALQIAASQIKSLVTADTL-PDTPQAQIMDAHLAFLEDPMLIEAAEAGLRSGA-SAAGAWHLACQSVEQHLRLH.ANPQVRERA
DSQ  CTCCGGGGCGTGGGTGCATCGCCGGGGGTGGCGGTCGGCCAGATCGTGCGCTGGAGCGGCATCGCACCCGAGTTCGATGAGACCGGC...---------GGCCCGTTCGAGCAGGAGCATGCGCGCTTGCATGCCGCCCTGCAGATCGCCGCCAGCCAGATCAAGTCGCTGGTGACGGCCGACACGCTG---CCCGATACGCCGCAGGCCCAGATCATGGACGCACATCTCGCCTTCCTCGAAGACCCGATGCTCATCGAGGCGGCCGAGGCCGGGCTGCGCAGCGGCGCC---AGCGCGGCGGGCGCCTGGCACCTGGCCTGCCAGTCCGTGGAGCAGCACCTGCGCCTGCAC...GCGAATCCCCAGGTGCGCGAGCGCGCG
TRN  11011111101111111
NAM  PTF1_RHOCA/274-395
ASQ  LVGISSSPGYALAPVFRFARDEVVFDTDA.---ADAAFETDRLDTALQTAWHELEELHDEVWKTSGPARAAIFRAHQEFLHDPEMVAEAKALIGQGR-SAGFAWHRVFSDRADMLGAM.KDAVLSGRA
DSQ  CTTGTGGGCATCTCCTCCTCGCCGGGCTACGCGCTTGCCCCCGTCTTCCGCTTTGCCCGCGACGAGGTGGTCTTTGACACCGACGCC...---------GCGGATGCGGCCTTTGAAACCGACCGGCTCGACACCGCGCTGCAGACCGCCTGGCACGAGCTGGAAGAGCTGCACGACGAGGTCTGGAAGACATCCGGCCCCGCCCGCGCCGCGATCTTCCGCGCGCATCAGGAGTTTTTGCACGACCCCGAAATGGTCGCCGAGGCGAAGGCGCTGATCGGGCAGGGCCGC---TCGGCCGGGTTTGCCTGGCACCGGGTCTTTTCCGACCGCGCCGACATGCTGGGGGCGATG...AAGGATGCGGTGCTGTCGGGCCGCGCC
TRN  11011111101111111
NAM  Q98C54_RHILO/6-122
ASQ  IEGVPASAGYAEGPLFDLDRPPAVYAGKA.----TLAEEKTSLQAAIGTAVSRLSAMAEAA----DSDAAGILEFHIAMLEDDALRGPAFASITSGQ-TADVAWREALDAEIAGYEAS.DQDYFRARA
DSQ  ATTGAGGGTGTTCCGGCCTCGGCCGGCTATGCCGAGGGGCCGCTGTTCGACCTCGACCGGCCGCCGGCCGTCTACGCAGGCAAAGCC...------------ACATTAGCGGAAGAGAAGACGTCGCTGCAAGCCGCGATCGGCACGGCAGTGAGCCGGCTTTCCGCCATGGCGGAGGCAGCC------------GACAGCGACGCCGCCGGCATACTCGAATTCCACATTGCCATGCTGGAAGACGACGCCTTGAGAGGGCCGGCCTTCGCGTCGATCACGTCCGGACAG---ACCGCCGACGTGGCATGGCGAGAGGCGCTCGATGCCGAGATCGCCGGTTACGAGGCCTCC...GACCAGGACTATTTCCGTGCCCGCGCC
TRN  10010101100011010
NAM  Q9HY55_PSEAE/403-521
ASQ  LQAIAASPGIASGPAHVQVAQRFEFQPRG.---ESPAHERERLLRAKRAVDEEIVGLVERSTV---KAIREIFVTHREMLDDPELAEQVQLRLNRGE-SAEAAWSRVVEDSAAQQEAL.HDALLAERA
DSQ  CTGCAGGCAATCGCCGCGTCGCCGGGCATCGCCAGTGGTCCGGCGCATGTCCAGGTGGCGCAGCGCTTCGAGTTCCAGCCGCGCGGC...---------GAGTCACCGGCCCATGAACGCGAGCGCCTGCTGCGGGCCAAGCGGGCGGTGGACGAGGAGATCGTCGGCCTGGTCGAACGCAGCACGGTG---------AAGGCGATCCGCGAGATTTTCGTCACCCACCGGGAGATGCTCGACGATCCGGAACTGGCCGAGCAGGTGCAACTGCGCCTGAATCGCGGCGAA---AGCGCCGAAGCGGCCTGGAGTCGGGTGGTGGAAGACAGCGCGGCGCAACAGGAGGCGCTG...CACGACGCGCTGCTCGCCGAGCGCGCC
TRN  11011111101111101
NAM  Q8VP40_ECOLI/10-125
ASQ  ISGLSVQNGIAIGPVKWFTCERPEITQRT.--VDSPQEELSRIESAIDIVVCEL-------ADKAAGPEGDIFAAHKMMLEDPEINRQLQQRLAKGK-QAEFAWLEVMQALAEQYCQA.ETLYLRERE
DSQ  ATATCAGGCTTGTCAGTACAAAATGGTATCGCTATTGGTCCTGTTAAATGGTTTACCTGCGAACGACCAGAAATTACGCAGCGCACC...------GTCGATTCTCCGCAAGAAGAGCTGTCGCGAATCGAGTCTGCTATCGACATTGTTGTTTGTGAACTT---------------------GCCGATAAAGCGGCAGGCCCTGAAGGCGATATTTTTGCCGCCCATAAAATGATGCTTGAAGATCCAGAGATTAACCGGCAATTACAGCAACGTCTGGCAAAGGGCAAA---CAGGCGGAATTCGCATGGTTAGAAGTCATGCAGGCATTAGCAGAGCAATATTGTCAGGCG...GAAACACTGTATTTACGTGAACGCGAG
TRN  10010101100011000
NAM  PT1_STRCO/5-124
ASQ  LRGVGVSHGVAIGEVRHMGTAVLEPPAKQ.IPAEDAEREQGRARKAVEAVAADLMARGNLA----GGEAQAVLEAQAMMAQDPELLADVERRITVGS-TAERAVYDAFAAYRALLAG-.AGEYLAGRV
DSQ  CTGCGAGGCGTCGGCGTGAGCCACGGTGTGGCGATCGGCGAGGTTCGGCACATGGGGACGGCGGTTCTGGAACCGCCGGCGAAGCAG...ATTCCGGCCGAGGACGCGGAGCGTGAGCAGGGGCGCGCCCGCAAGGCGGTGGAAGCTGTGGCGGCCGATCTGATGGCGCGCGGCAACCTGGCC------------GGGGGCGAGGCGCAGGCCGTGCTCGAGGCGCAGGCCATGATGGCCCAGGACCCGGAACTGCTGGCCGACGTCGAGCGGCGGATCACCGTCGGGAGC---ACGGCCGAGCGTGCCGTGTACGACGCCTTCGCCGCCTACCGGGCCCTGCTGGCCGGT---...GCCGGTGAGTACCTGGCCGGCCGCGTG
TRN  11011111101111111
NAM  DHAM_ECOLI/251-370
ASQ  LRPVPPVSG----KAFYYQPVLCTVQAKS.--TLTVEEEQDRLRQAIDFTLLDLMTLTAKAEASGLDDIAAIFSGHHTLLDDPELLAAASELLQHEHCTAEYAWQQVLKELSQQYQQL.DDEYLQARY
DSQ  CTGCGTCCCGTTCCGCCTGTTTCGGGT------------AAAGCCTTTTATTATCAACCAGTTTTATGTACGGTACAGGCAAAATCA...------ACCCTGACCGTGGAAGAAGAACAAGATCGATTACGCCAGGCTATTGACTTCACGTTATTAGATCTGATGACGTTAACAGCGAAAGCAGAAGCCAGCGGGCTTGACGATATTGCCGCAATCTTTTCTGGTCACCATACACTGTTAGATGATCCGGAACTGCTGGCGGCGGCAAGCGAACTCCTTCAGCATGAACATTGCACGGCAGAATATGCCTGGCAGCAAGTTCTTAAAGAACTTAGCCAGCAATACCAGCAACTG...GATGATGAATATCTACAAGCTCGCTAT
TRN  11011101101011000
NAM  PT1_LACSK/4-128
ASQ  LRGIAASDGIATAKAYMLVQPDLSFSKST.ISD--SEKEINRLHKALQDSTSDLETIRKIAAESLGEEEAQVFDAHMMILADPEFTGAIEGKINDDKVNAEQALKEVADLFVATFESMtNNAYMQERA
DSQ  CTAAGAGGGATTGCTGCCAGTGATGGTATCGCTACTGCGAAAGCCTACATGTTAGTGCAACCCGATTTGTCATTTTCGAAATCAACT...ATTTCAGAT------TCAGAAAAAGAGATTAATCGTTTGCATAAGGCCTTACAAGATTCTACGAGTGATCTAGAGACCATTCGGAAGATTGCTGCTGAATCATTAGGAGAAGAAGAAGCACAAGTTTTTGACGCTCACATGATGATTTTAGCAGACCCAGAATTTACCGGCGCTATCGAAGGTAAAATCAATGATGACAAGGTTAATGCTGAGCAAGCGTTGAAAGAGGTCGCGGATTTATTCGTGGCCACTTTTGAGTCTATGactAATAACGCATACATGCAAGAACGTGCT
TRN  10010101110011000
NAM  Q9KJV2_LACCA/5-129
ASQ  LKGIAASDGIATAKAYLLVQPDLSFQKKT.VDD--PSKEIDRLKQSLDQSNDELKVIRAKAAESLGEEEAQVFDAHMMILADPDFTGQVETKIKDEKVNAEQALKEVSEFFIKTFEGMtDNPYMQERA
DSQ  TTGAAGGGAATCGCTGCTAGTGATGGGATCGCCACAGCGAAGGCCTATTTACTGGTTCAACCTGATTTGTCATTCCAAAAAAAGACG...GTTGATGAT------CCTTCAAAGGAAATCGATCGCCTGAAGCAGTCACTTGATCAAAGTAATGATGAGTTAAAGGTTATTCGAGCAAAGGCCGCTGAATCGCTTGGCGAAGAAGAGGCTCAGGTTTTTGATGCGCACATGATGATTTTGGCTGATCCTGACTTTACTGGTCAGGTAGAGACTAAGATCAAGGATGAAAAAGTCAATGCTGAGCAGGCTTTGAAAGAAGTCTCCGAATTCTTTATTAAGACATTCGAAGGTATGaccGACAATCCATATATGCAGGAACGTGCG
TRN  11011101101011000
NAM  Q99Z66_STRPY/5-129
ASQ  LKGIAASDGVAVAKAYLLVQPDLSFETVT.VAD--TNAEEARLDVALQAAQDELSVIRENAVESLGEEAAAVFDAHLMVLADPEMISQVKETIRAKQTNAETGLKEVTDMFITIFEGMeDNPYMQERA
DSQ  CTTAAAGGAATTGCAGCCTCAGACGGCGTTGCTGTTGCTAAAGCATATCTACTAGTTCAGCCGGATTTGTCATTTGAGACTGTTACA...GTCGCAGAT------ACAAATGCAGAAGAAGCTCGCCTTGATGTTGCACTCCAAGCTGCACAAGACGAGCTTTCTGTTATCCGTGAAAATGCAGTAGAAAGCTTAGGTGAAGAAGCAGCAGCCGTTTTTGATGCCCATTTGATGGTTCTTGCTGATCCAGAAATGATCAGCCAGGTTAAAGAAACGATTCGCGCAAAACAAACGAATGCAGAAACAGGTCTTAAAGAAGTGACTGACATGTTCATCACCATCTTTGAAGGCATGgaaGATAACCCATACATGCAAGAACGTGCA
TRN  11011101111011000
NAM  PT1_LACLC/5-129
ASQ  LKGIAASSGVAVAKAYLLVQPDLSFETKT.IAD--TANEEARLDAALATSQSELQLIKDKAVTTLGEEAASVFDAHMMVLADPDMTAQIKAVINDKKVNAESALKEVTDMFIGIFEGMtDNAYMQERA
DSQ  CTTAAAGGTATCGCCGCATCATCAGGTGTAGCAGTAGCTAAGGCATACTTGCTTGTCCAACCAGATTTGTCTTTTGAAACAAAGACA...ATTGCTGAT------ACAGCTAATGAAGAAGCTCGCCTTGATGCAGCACTTGCTACATCGCAAAGCGAGCTTCAACTTATTAAGGACAAAGCAGTAACAACCCTTGGTGAAGAAGCAGCATCTGTATTTGACGCTCATATGATGGTCCTTGCTGACCCAGATATGACTGCTCAAATCAAAGCAGTAATAAATGACAAAAAAGTTAACGCTGAATCAGCTCTTAAAGAAGTAACTGATATGTTTATCGGTATCTTTGAAGGAATGactGACAATGCTTATATGCAAGAACGTGCA
TRN  10010101110011001
NAM  PT1_BACSU/4-127
ASQ  LKGIGASAGIAIAKAYRLEEPDLTVEKKN.ISD--SEAEVSRFDEAIARSKEELEKIKEHALKELGQDKADIFSAHLLVLSDPELLNPVKEKISTDSVNAEFALKETSSMFVTMFESM.DNEYMKERA
DSQ  TTAAAAGGGATTGGTGCTTCAGCCGGCATCGCGATTGCAAAAGCGTACCGGCTTGAAGAGCCAGATTTAACGGTTGAAAAGAAAAAC...ATCTCTGAT------TCTGAAGCGGAAGTAAGCCGTTTTGATGAAGCGATTGCACGTTCAAAAGAAGAGCTCGAAAAAATCAAAGAGCACGCTTTGAAAGAACTGGGTCAGGATAAAGCTGATATTTTTTCTGCTCACCTTTTAGTTCTCAGTGACCCTGAGCTTCTGAACCCTGTGAAAGAAAAAATCAGCACTGATTCAGTGAACGCTGAATTCGCTTTAAAAGAAACGTCTTCTATGTTCGTTACTATGTTTGAATCTATG...GACAACGAATATATGAAAGAGCGTGCG
TRN  11011101101011000
NAM  PT1_BACSI/10-133
ASQ  IHGIAASSGIAIAKAYRLETPDLAAEKRA.VAD--VEAEVARFEAAVAKAKEELEAIKQHALEKLGEDKAAIFAAHLLVLDDPELLNPIKEKIQTERVNAEYSLDETASFFISMFEAM.DNEYMKERA
DSQ  ATCCATGGGATTGCTGCATCGAGCGGTATTGCCATCGCGAAGGCATACCGCTTAGAAACCCCTGATTTGGCAGCCGAAAAACGGGCT...GTTGCCGAT------GTGGAAGCGGAAGTAGCGCGGTTTGAGGCGGCGGTGGCGAAAGCGAAAGAAGAGCTGGAAGCCATCAAGCAGCATGCCTTGGAAAAGCTTGGCGAAGATAAAGCTGCCATTTTTGCCGCCCACTTGCTTGTGCTTGACGACCCAGAATTGTTGAACCCGATTAAAGAAAAAATCCAAACGGAGCGCGTCAATGCCGAGTACTCTCTCGATGAAACCGCCTCGTTTTTCATCTCGATGTTCGAGGCGATG...GACAATGAATATATGAAAGAACGGGCC
TRN  11011101101011010
NAM  PT1_BACME/5-128
ASQ  IQGIAASSGIAIAKAFRLENPELTVEKKS.VTE--VEAEVARLEAALEKSKSELEIIREHARKELGDDKAEIFEAHLLVLSDPELINPIKDKITNENVNAEHALDEVAAMFINMFESM.DNEYMKERA
DSQ  ATTCAAGGCATTGCCGCTTCTAGCGGCATTGCTATTGCTAAAGCATTTCGTCTAGAAAATCCAGAATTAACCGTTGAAAAAAAATCA...GTAACTGAA------GTTGAAGCAGAAGTAGCACGTCTAGAAGCTGCGCTAGAAAAGTCAAAATCAGAACTTGAAATTATTAGAGAGCACGCTCGTAAAGAACTTGGAGATGACAAAGCAGAAATCTTTGAAGCTCACTTATTAGTTCTAAGCGATCCTGAACTTATTAATCCAATTAAAGATAAAATTACAAATGAAAATGTAAACGCTGAACATGCACTTGATGAAGTAGCGGCAATGTTTATTAATATGTTTGAGTCAATG...GACAATGAATATATGAAAGAACGTGCT
TRN  10010101110011000
NAM  PT1_LISIN/5-128
ASQ  LKGIAASDGIAIAKAYLLVEPDLSYEKTE.VTD--VESEVKRFESALEVSRTELSTIREKAAKDLGEDKAQIFDAHLLVLNDPELTGPIEESIKNAKTNAETALQETTDMFIGMFESM.DNEYMRERA
DSQ  TTGAAAGGTATCGCAGCATCTGATGGGATTGCCATTGCGAAAGCTTATCTGCTCGTTGAACCTGATCTTTCCTATGAAAAAACTGAA...GTTACGGAT------GTTGAAAGTGAAGTAAAACGTTTTGAAAGCGCGTTAGAAGTTTCTAGAACAGAACTTTCAACGATTCGTGAAAAAGCAGCTAAAGACTTAGGCGAAGATAAGGCACAAATTTTTGACGCGCATCTTCTAGTTTTAAACGATCCTGAATTAACAGGACCAATTGAAGAAAGCATCAAAAATGCTAAAACGAATGCAGAAACAGCTTTACAAGAAACGACAGACATGTTTATTGGTATGTTTGAATCTATG...GACAACGAATACATGCGTGAACGTGCA
TRN  10010101100011000
NAM  PT1_STAAN/5-129
ASQ  IKGIAASDGVAIAKAYLLVEPDLTFDKNEkVTD--VEGEVAKFNSAIEASKVELTKIRNNAEVQLGADKAAIFDAHLLVLDDPELIQPIQDKIKNENANAATALTDVTTQFVTIFESM.DNEYMKERA
DSQ  ATTAAAGGTATTGCTGCATCTGATGGTGTCGCAATTGCTAAAGCTTATTTATTAGTTGAGCCAGACTTAACATTCGACAAAAATGAAaaaGTCACTGAT------GTTGAAGGAGAAGTTGCAAAGTTCAATAGCGCTATCGAAGCTTCTAAAGTTGAGTTAACTAAAATTAGAAATAATGCAGAGGTTCAACTAGGTGCTGATAAAGCTGCTATCTTTGATGCACATTTATTAGTTTTAGATGACCCTGAATTAATTCAACCAATCCAAGATAAGATTAAAAATGAAAACGCTAATGCTGCTACAGCATTAACGGATGTAACAACACAATTTGTTACAATTTTTGAATCTATG...GATAACGAATACATGAAAGAACGTGCG
TRN  10010101110011010
NAM  PT1_BACHD/5-128
ASQ  ITGIAASSGVAIAKAFIHLEPNVDIEKTS.ITD--VSTEIEKLTAALEKSKEELRAIKDQTEASMGADKAEIFAAHLLVLDDPELVDGIKGKIENEQMNAEYALKEVSDMFVSMFESM.DNEYMKERA
DSQ  ATTACTGGCATCGCTGCGTCATCTGGCGTAGCGATCGCCAAAGCATTCATTCACCTAGAACCAAACGTTGACATAGAAAAAACGTCC...ATCACAGAT------GTTTCAACAGAGATCGAAAAATTAACAGCCGCTCTCGAAAAATCAAAAGAAGAGCTAAGAGCGATCAAAGATCAAACAGAAGCTAGTATGGGAGCTGACAAGGCTGAGATTTTTGCGGCGCATTTGCTAGTACTTGACGACCCTGAACTCGTAGATGGGATCAAAGGGAAAATCGAGAATGAGCAAATGAACGCAGAATATGCATTAAAAGAAGTATCCGATATGTTTGTCTCCATGTTTGAAAGCATG...GACAATGAATATATGAAAGAACGAGCG
TRN  10010101110011000
NAM  Q93TM5_LACBR/2-126
ASQ  LKGIAASDGVVCGHVFRYSEPDLSITKRS.ITN--LDHELNRFHQALEAAVSEVEMIKTRATKNLGADSAQVFSAHIAMLQDPEFIKSVEDEIARQRCNAEAALATVVTDYGASLAKLtDNPYMQERI
DSQ  CTCAAGGGAATTGCCGCTAGTGATGGGGTTGTTTGCGGTCATGTATTTCGCTACAGCGAACCGGATCTATCTATCACCAAACGGTCA...ATCACTAAT------CTTGATCACGAATTAAATCGATTCCATCAGGCCCTTGAAGCAGCCGTCTCCGAAGTTGAGATGATTAAAACTCGTGCAACTAAAAACCTGGGCGCTGATAGTGCCCAGGTTTTTAGTGCCCATATTGCCATGCTCCAGGACCCGGAATTCATTAAATCAGTTGAAGATGAGATAGCTCGGCAGCGGTGTAACGCCGAGGCAGCGCTAGCAACGGTGGTCACCGATTATGGTGCCTCATTGGCGAAATTAacgGATAATCCATATATGCAAGAGCGGATC
TRN  10010101100011000
NAM  Q8XHW9_CLOPE/2-125
ASQ  KKGIAASKGYAIGTVFIQEHEEIIISDAK.VSD--IAAEKEKLSKALAQSKEQLEAIKEKTANEIGEHEAQVFEAHLMLLDDVEFTGQMEMTIENDQLNAMKAVQNVTDTFVMIFDSM.DDPYMRERA
DSQ  AAAAAAGGTATTGCTGCTTCAAAAGGATATGCAATAGGAACTGTATTTATACAAGAACATGAGGAAATAATAATATCTGATGCGAAG...GTTTCAGAT------ATAGCAGCTGAAAAAGAAAAATTATCTAAAGCTTTAGCTCAATCAAAAGAGCAATTAGAAGCAATAAAAGAAAAAACAGCTAATGAAATTGGAGAACATGAAGCTCAAGTTTTTGAAGCTCATTTAATGTTATTAGATGATGTAGAGTTTACTGGTCAAATGGAAATGACTATAGAAAATGACCAATTAAACGCTATGAAAGCTGTTCAAAATGTTACAGATACTTTCGTTATGATATTTGATTCTATG...GATGACCCTTACATGAGAGAAAGGGCA
TRN  10010101110011000
NAM  Q97EM3_CLOAB/3-126
ASQ  KKGISASKGYAIGHVFIKADNEVKIVEKK.ISD--IESEKARLQGAVEKAREQLTKIKEKAEKDLGADKAAVFESHMMFLDDPDFIGSAENIISDEMINAEKALENVMKNYVAIFEGI.EDEYVKERI
DSQ  AAAAAAGGAATATCTGCCTCAAAAGGATATGCTATAGGACATGTTTTTATTAAAGCCGATAATGAAGTTAAAATAGTTGAAAAAAAG...ATAAGTGAT------ATAGAAAGCGAAAAAGCTAGACTCCAAGGTGCAGTTGAAAAAGCAAGAGAGCAACTCACAAAAATCAAAGAAAAAGCAGAAAAAGATTTAGGTGCTGATAAAGCAGCAGTATTTGAAAGTCATATGATGTTTCTTGATGATCCAGATTTTATTGGTTCAGCAGAAAATATAATCTCAGACGAAATGATTAATGCTGAAAAAGCACTTGAAAACGTAATGAAAAATTATGTAGCAATCTTTGAAGGCATT...GAAGATGAATATGTAAAAGAGAGAATT
TRN  10010101110011000
NAM  Q98PW7_MYCPU/3-123
ASQ  LKGIGASRGIAIAKVFRILEDEIEIPKNS.LG---VEKETENFKKTCEKILNELKEIEKKLLIS-KPEEAAIFQAHQDIASDPVMQEEIIDLIKNNK-SAMQAVDEVYQRYSELFESM.DDEYMRERA
DSQ  CTAAAAGGAATTGGAGCATCAAGAGGAATTGCAATTGCTAAAGTTTTTAGAATTCTAGAAGATGAAATTGAAATTCCAAAAAACTCA...TTAGGT---------GTTGAAAAAGAAACAGAAAACTTTAAAAAAACTTGTGAAAAAATTTTAAATGAGCTTAAAGAAATTGAAAAAAAACTGTTAATTTCA---AAACCAGAAGAGGCAGCTATTTTTCAAGCTCATCAAGATATTGCAAGTGATCCTGTTATGCAAGAGGAAATTATTGATCTTATCAAAAATAATAAA---AGTGCAATGCAAGCTGTTGATGAGGTTTATCAAAGATATAGTGAGCTTTTTGAATCTATG...GATGATGAATATATGAGAGAAAGAGCC
TRN  10010101100011000
NAM  PT1_MYCCA/5-128
ASQ  IKGIAASEGISLARALVIKETKLDIQKQL.ISD--VDQEIIKLEQAIEKSIADLKKIQQITLKKLGEEKAAIFDAHQDIANDPAIKEEVVELIKKEKVNAEYALFTVSNNYFEMFSQL.EDPYFKERS
DSQ  ATTAAAGGAATTGCTGCAAGTGAAGGAATTTCTTTAGCAAGAGCTCTTGTTATAAAAGAAACCAAACTTGATATACAAAAGCAATTA...ATTTCAGAT------GTTGATCAAGAAATTATCAAATTAGAACAAGCAATTGAAAAATCTATAGCTGATTTAAAAAAAATTCAACAAATTACATTAAAAAAATTAGGAGAAGAAAAGGCTGCTATTTTTGATGCTCATCAAGATATTGCAAATGATCCTGCTATTAAAGAAGAAGTTGTTGAATTGATTAAAAAAGAAAAAGTGAATGCTGAATATGCACTTTTTACAGTATCTAATAACTATTTTGAAATGTTTAGTCAATTA...GAAGATCCATATTTTAAAGAAAGAAGT
TRN  10010101110011000
NAM  Q8RI43_FUSNN/11-134
ASQ  IKGIPASPGIAIGKAFLYKENKLEIDEKS.NLSK--EEEIERLVKGREIAKKQLEEIKENTLKKLGKDKADIFEGHITLLEDEELFSEIDSKISQKKCTAEFALNEAIDEYATMLANL.EDTYFKERA
DSQ  ATAAAAGGAATTCCAGCTTCACCTGGGATAGCAATAGGAAAAGCATTTCTATATAAAGAAAATAAATTAGAAATAGATGAAAAATCT...AATTTATCTAAA------GAAGAAGAGATAGAAAGATTAGTAAAAGGTAGAGAAATTGCTAAAAAACAACTGGAAGAAATCAAAGAAAATACTTTAAAAAAATTAGGGAAAGATAAGGCTGATATTTTTGAAGGGCATATCACTTTATTGGAAGATGAAGAGTTATTTTCTGAAATTGATTCAAAAATTTCTCAAAAAAAGTGTACTGCTGAATTTGCATTAAATGAAGCTATTGATGAATATGCAACTATGCTTGCAAATTTA...GAAGATACGTATTTTAAAGAAAGAGCA
TRN  10010101100011000
NAM  Q9KTD7_VIBCH/2-127
ASQ  ISGILASPGIAIGKALLLQEDEIVLNTNT.ISDDQVEAEVERFYTARDKSSAQLEVIKQKALETFGEEKEAIFEGHIMLLEDEELEEEILALIKKEKMSADNAIHTVIEEQATALESL.DDEYLKERA
DSQ  ATTTCAGGCATTCTAGCATCTCCAGGTATTGCTATTGGTAAAGCATTACTTCTTCAAGAAGATGAAATTGTCCTAAACACAAACACC...ATTTCTGACGATCAAGTAGAAGCCGAAGTTGAGCGCTTTTACACTGCGCGTGACAAATCTTCTGCGCAGTTAGAAGTGATCAAACAAAAAGCACTTGAAACTTTTGGTGAAGAAAAAGAAGCCATCTTTGAAGGCCATATCATGTTGCTTGAAGATGAAGAGCTAGAAGAAGAGATTTTAGCCCTCATCAAAAAAGAAAAAATGTCTGCCGATAACGCGATTCATACCGTTATCGAAGAGCAAGCCACTGCGCTTGAATCTTTA...GACGATGAATATCTCAAAGAACGTGCA
TRN  11011101111011000
NAM  PT1_SALTY/2-127
ASQ  ISGILASPGIAFGKALLLKEDEIVIDRKK.ISADKVDQEVERFLSGRAKASAQLEAIKTKAGETFGEEKEAIFEGHIMLLEDEELEQEIIALIKDKHMTADAAAHEVIEGQATALEEL.DDEYLKERA
DSQ  ATTTCAGGCATTTTAGCATCCCCGGGTATCGCTTTCGGCAAAGCACTGCTGCTGAAAGAAGACGAAATCGTCATTGACCGGAAAAAA...ATTTCTGCCGACAAGGTTGATCAGGAAGTTGAACGTTTTCTGAGCGGTCGTGCCAAGGCATCTGCGCAACTGGAAGCGATCAAGACAAAAGCTGGTGAAACGTTCGGTGAAGAAAAAGAAGCCATCTTTGAAGGGCATATTATGCTGCTCGAAGATGAGGAGCTGGAGCAGGAAATCATAGCCCTGATTAAAGATAAGCACATGACGGCTGACGCAGCCGCACATGAAGTTATCGAAGGTCAGGCCACTGCCCTGGAAGAACTG...GATGACGAATACCTGAAAGAGCGTGCG
TRN  10010101100011000
NAM  PT1_BUCAP/2-127
ASQ  ISGILASPGIAFGNVLLLKKEEIVINRQN.ISTENIKTEINKFFNGRKKSVKQLTEIKIATGEKFGKKKEGIFEGHIMLLEDEELEKEIINLITEKKISAAEATKFIIEGQAKALEKI.KDEYLKNRA
DSQ  ATTTCAGGCATTTTAGCATCACCCGGTATAGCTTTTGGCAATGTACTTTTATTAAAAAAAGAAGAAATTGTCATTAACCGGCAAAAT...ATTTCTACTGAAAATATAAAAACAGAAATAAATAAGTTTTTTAACGGTAGAAAAAAATCAGTAAAACAACTAACAGAAATAAAAATAGCAACAGGCGAAAAATTTGGAAAGAAAAAAGAAGGTATCTTCGAAGGTCATATAATGCTTCTTGAAGACGAAGAACTGGAAAAAGAAATAATCAACTTAATAACAGAAAAAAAAATATCTGCTGCAGAAGCAACAAAATTCATTATTGAAGGACAAGCAAAAGCATTAGAAAAAATA...AAAGACGAATATTTAAAAAACAGAGCA
TRN  10010101100011000
NAM  PT1_BUCAI/2-127
ASQ  ISGILASPGIAFGTALLLKEDEIVINRKI.INIKNITKEIERFFEGRRKSIQQLTEIKTKTKEKFGEKKESIFEGHIMLLEDEELEQEVISLIKEKNMSAAAATELIIEGQAKALEKL.KDEYLKNRA
DSQ  ATTTCAGGCATTTTAGCATCACCGGGTATAGCTTTTGGAACAGCTCTTTTATTAAAAGAAGATGAAATTGTTATTAACCGGAAAATA...ATTAATATTAAAAATATTACAAAAGAAATAGAAAGATTTTTTGAAGGAAGAAGAAAATCAATTCAACAACTCACAGAAATAAAAACTAAGACAAAAGAAAAGTTTGGAGAAAAAAAAGAAAGTATTTTTGAAGGACATATTATGCTTCTTGAAGATGAAGAGCTAGAACAAGAAGTTATTTCTTTAATAAAAGAAAAAAATATGTCGGCTGCAGCAGCAACTGAATTAATTATTGAAGGACAAGCAAAAGCTCTGGAAAAATTG...AAAGATGAATATTTAAAAAATAGAGCA
TRN  10010101100011000
NAM  Q9CMD3_PASMU/2-127
ASQ  ISGIPASPGIVFGKALVLKEEKIVLDMQK.ISESQIDSEIARFYQGRNAAVEQLSAIRDRAAKTLGEEKAAIFEGHLMILEDEELEEEIIDYLRTNKVNAGVAASKIIDQQVTMLSEI.DDEYLRERA
DSQ  ATTTCAGGAATTCCAGCTTCACCAGGTATCGTTTTTGGTAAAGCCTTAGTGCTTAAAGAAGAAAAAATTGTACTGGATATGCAAAAA...ATCAGTGAATCTCAGATTGATTCGGAAATTGCACGTTTTTATCAAGGACGAAATGCGGCAGTAGAACAGCTTAGTGCCATTCGCGATCGGGCGGCGAAGACCTTAGGTGAAGAAAAAGCAGCAATTTTTGAAGGTCATTTGATGATCTTGGAAGATGAGGAGTTGGAAGAAGAAATTATCGATTATTTGCGTACAAATAAAGTGAATGCGGGTGTAGCTGCAAGTAAAATTATTGATCAGCAAGTCACGATGTTATCTGAAATT...GATGATGAATATTTAAGAGAACGTGCC
TRN  10010101100011000
NAM  Q8R7R4_THETN/2-127
ASQ  LKGVAASPGIAIGKAFLYTKEKVTINVEK.IEESKVEEEIAKFRKALEVTQEEIEKIKEKALKEFGKEKAEIFEAHLMLASDPELIEGVENMIKTELVTADNAVNKVIEQNASVMESL.NDEYLKERA
DSQ  TTAAAAGGAGTTGCGGCATCGCCTGGAATAGCTATAGGCAAAGCTTTTTTGTATACCAAAGAAAAAGTGACAATAAATGTAGAAAAA...ATTGAAGAATCGAAAGTGGAAGAGGAAATTGCGAAATTTAGAAAGGCTTTGGAAGTTACACAGGAGGAGATAGAGAAAATCAAGGAAAAAGCTTTGAAAGAATTTGGAAAAGAAAAAGCAGAAATTTTTGAAGCACATTTGATGCTGGCAAGTGACCCCGAACTTATTGAAGGGGTAGAAAACATGATTAAAACAGAACTTGTAACAGCTGATAACGCAGTTAATAAGGTTATAGAGCAAAATGCTTCTGTGATGGAAAGTTTG...AATGACGAATATTTGAAAGAGAGAGCT
TRN  10010101100011010
NAM  Q9RGC5_MYCHY/9-130
ASQ  FKGIGASSGIAIAKVFKLVEQKIEISDQK.VED--ISTEIQIFEEGVKKSVSQIEKIKKLATK-LAKDELEILDAHILIATDPVLKEDTINLIKQGY-SAAYSLKETAKNHTNFLLET.GDEYLMARA
DSQ  TTTAAAGGAATCGGGGCCTCAAGCGGAATTGCAATCGCAAAAGTTTTTAAATTAGTTGAACAAAAAATTGAAATTAGTGATCAAAAA...GTTGAGGAT------ATTAGCACTGAAATTCAAATTTTTGAAGAGGGGGTAAAAAAATCTGTTAGCCAAATTGAAAAAATTAAAAAATTAGCAACTAAG---TTAGCAAAAGATGAGCTCGAAATTCTTGATGCTCATATTTTGATTGCAACAGATCCTGTTCTTAAAGAAGATACAATCAATTTAATCAAGCAAGGATAT---TCAGCTGCTTATTCTTTAAAAGAAACGGCAAAAAATCATACTAATTTTTTACTTGAAACC...GGGGATGAATATTTAATGGCTCGAGCA
TRN  11011101111011000
NAM  PT1_MYCGE/4-128
ASQ  IIGIGVSDGIAVAKAFIIQTPQFDVKKYT.NVKMTPTQAKKLLSSAFQKAKKDLEEIKTITVKNINQEAGMIFDAHIQILNDPTITEQLEQQLNKNI-HPVIAVDNVFQQTALMFSEM.DDKYFKERA
DSQ  ATAATTGGGATTGGTGTTTCAGATGGCATTGCTGTTGCAAAAGCTTTCATTATTCAAACACCTCAATTTGACGTTAAAAAATACACA...AATGTCAAAATGACACCCACCCAAGCAAAAAAGCTTTTAAGCAGTGCTTTTCAAAAAGCAAAAAAAGACCTTGAAGAGATTAAGACAATTACTGTTAAGAATATTAATCAAGAAGCAGGAATGATTTTTGATGCACACATCCAAATTCTTAATGATCCTACTATCACTGAGCAATTAGAACAACAACTAAATAAAAACATC---CATCCTGTTATTGCTGTTGATAATGTTTTTCAACAAACAGCTTTAATGTTTAGTGAAATG...GATGATAAGTATTTTAAAGAACGTGCC
TRN  10010101110011000
NAM  PT1_MYCPN/4-128
ASQ  LSGIGVSDGMALAKAFLVKTPEFAVNKYL.KHQLTKAQAKRLLDSAFKKAVKDLEEIKEITVNNINTEAGMIFDAHIQMLNDPTITEQLEQQLAQNV-HPVIAVDTVFSQTATMFSQM.QDKYFQERA
DSQ  CTATCTGGTATCGGTGTATCTGATGGCATGGCCCTAGCCAAAGCCTTCCTTGTTAAAACACCGGAATTCGCTGTTAACAAATACCTC...AAGCACCAATTAACGAAGGCGCAGGCCAAAAGACTTTTGGACTCAGCTTTCAAAAAAGCCGTTAAGGACTTAGAGGAAATTAAGGAAATTACCGTTAACAACATTAACACTGAAGCGGGCATGATCTTTGATGCGCACATTCAAATGCTCAACGATCCCACGATCACCGAGCAACTAGAACAACAGTTAGCGCAAAATGTT---CATCCTGTTATAGCCGTGGACACTGTCTTTAGCCAAACGGCTACCATGTTTAGCCAAATG...CAGGACAAGTATTTCCAGGAACGTGCT
TRN  10010101110011000
NAM  PT1_BORBU/3-129
ASQ  LSGKRISKGIGIGEVLCIRKNFDKIISREkIDFSQVDSEISKFNKAKSKAIEALRDLERKAMLQFGDDKKGIFEGQVLIVEDDELDELVIELIVKENYSAAYSIYLAFENLVKSVEDY.KDPYLKERA
DSQ  TTATCGGGCAAAAGAATATCCAAAGGGATAGGCATTGGGGAAGTTCTTTGTATTAGGAAAAATTTTGATAAAATTATAAGTAGAGAAaaaATAGACTTTTCTCAGGTTGATAGCGAGATATCAAAATTCAATAAAGCGAAGTCAAAAGCAATTGAAGCGCTTAGGGATCTTGAGAGAAAAGCTATGCTTCAATTTGGAGATGATAAAAAAGGTATTTTTGAAGGTCAGGTGTTGATCGTTGAAGACGATGAACTTGATGAGCTTGTTATTGAGCTTATTGTAAAGGAAAATTATAGCGCTGCTTATTCTATTTATTTAGCGTTTGAAAATTTGGTTAAAAGTGTAGAAGATTAT...AAAGATCCTTATTTAAAAGAAAGAGCG
TRN  10010101110011000
NAM  Q9RNG5_LEGPN/185-310
ASQ  LTGIGSVPGIGIGTAVVVYPPADIDAVPR.NPVEELEDEINAFYEALETTRDDIRRLSKRMKETVAEEEHALFDVYLRILDRDSLGAEVEHVIREEKISAQAALATVIKKHVQQFESM.GDDYLRERA
DSQ  CTGACTGGAATAGGCAGTGTTCCTGGTATAGGAATTGGTACTGCCGTGGTTGTGTACCCGCCTGCGGATATTGATGCTGTCCCTCGT...AATCCGGTTGAGGAATTGGAAGATGAAATCAATGCGTTTTATGAAGCTTTGGAAACGACAAGAGATGATATCAGGCGTTTAAGTAAACGCATGAAAGAAACTGTTGCTGAGGAAGAGCATGCTTTATTCGATGTGTATTTAAGAATTTTGGATAGGGATAGCTTGGGTGCTGAAGTAGAGCATGTGATTCGTGAAGAGAAAATCAGCGCTCAAGCTGCCCTGGCTACAGTGATCAAGAAACACGTGCAGCAATTTGAAAGCATG...GGCGATGATTATCTGCGCGAACGAGCC
TRN  10010101100011010
NAM  Q9X4P3_PSEAE/178-302
ASQ  FVGVPGAPGVGVGKAVVVLPPADLEVVPD.KQVDDIDAEIALFKQALEGVRADMRALSSKLASQLRKEERALFDVYLMMLDDASIGNEVKRIIRTGQ-WAQGALRQVVMEHVQRFELM.DDAYLRERA
DSQ  TTCGTCGGCGTGCCCGGCGCCCCCGGGGTCGGGGTGGGCAAGGCGGTGGTGGTGTTGCCTCCGGCCGACCTGGAAGTGGTGCCGGAC...AAGCAGGTCGACGACATCGACGCCGAGATCGCCCTGTTCAAGCAGGCCCTGGAGGGCGTTCGCGCCGACATGCGCGCGCTGTCGAGCAAGCTCGCCAGCCAGTTGCGCAAGGAAGAACGCGCGCTGTTCGACGTCTACCTGATGATGCTCGACGATGCCTCCATCGGCAACGAGGTCAAGCGCATCATCCGTACCGGCCAG---TGGGCCCAGGGCGCCCTGCGCCAGGTGGTGATGGAGCACGTGCAGCGCTTCGAGCTGATG...GACGACGCCTATCTCCGCGAGCGCGCC
TRN  11011111101111111
NAM  Q8ZHU9_YERPE/171-295
ASQ  IRALAAAPGVAVAEGWQDISQPSLDLVYE.ASTLDSTLERERLTQALEEAAAEFRRFSKRFAASSQKESAAIFDLYSHLLNDARLKRELFAQIDAGA-VAEWAVKQVVEAFAAQFASL.QDTYMRERA
DSQ  ATCCGTGCATTGGCGGCGGCTCCTGGTGTCGCGGTGGCAGAAGGCTGGCAAGATATCTCACAGCCTTCGCTTGATCTGGTCTATGAG...GCCTCAACGCTTGATAGCACCCTTGAACGTGAACGTCTGACTCAGGCCTTGGAAGAGGCTGCGGCTGAGTTTCGTCGCTTCAGTAAGCGCTTTGCCGCCAGTTCACAAAAAGAGAGTGCGGCAATTTTCGATCTCTACTCCCACTTGCTAAATGATGCTCGCTTAAAGCGTGAGCTATTTGCGCAAATTGATGCAGGCGCG---GTGGCTGAGTGGGCGGTTAAACAGGTGGTTGAGGCGTTTGCTGCCCAGTTTGCCAGTCTG...CAAGATACCTATATGCGCGAGCGTGCT
TRN  11011101101011000
NAM  Q8Z411_SALTI/171-295
ASQ  IRALPAAPGVAIATGWQDATMPLMEQVYE.ASTLDTSLERERLTGALEEAANEFRRYSKRFAAGAQKETAAIFDLYSHLLSDARLRRELFAEVDKGA-VAEWAVKKIIEKFAEQFAAL.TDNYLKERA
DSQ  ATTCGCGCGCTTCCTGCGGCGCCGGGCGTGGCTATCGCAACGGGCTGGCAAGACGCGACCATGCCGCTGATGGAACAGGTTTACGAA...GCGTCTACGCTGGATACCTCTCTTGAACGCGAACGATTGACCGGCGCGCTGGAAGAGGCGGCGAACGAATTCCGACGATACAGCAAACGCTTTGCCGCCGGCGCACAAAAAGAGACGGCAGCCATTTTCGATCTGTACTCACACCTGCTTTCAGACGCCAGACTGCGTCGCGAACTCTTCGCCGAGGTCGACAAAGGCGCT---GTTGCGGAGTGGGCCGTTAAAAAAATCATCGAAAAATTTGCCGAGCAATTTGCGGCGCTA...ACCGATAACTACCTCAAAGAACGTGCG
TRN  10010101100011001
NAM  Q9KU52_VIBCH/171-295
ASQ  ITGVAASSGVAIGEFWWDDTQPDLSEVLP.ASALDPDFEQERIALAVENALADFRRMRKKLDGDINKEALAIFDLFTHLLNDPMLRKDLKAQIQKGD-RADWALRQVVESYSNRFARM.SDVYLRERA
DSQ  ATTACGGGTGTTGCCGCCTCTTCTGGGGTCGCGATTGGTGAGTTTTGGTGGGATGATACCCAGCCAGATCTGTCCGAAGTGCTACCC...GCCTCAGCTCTGGATCCTGATTTTGAGCAAGAGCGTATTGCCTTGGCAGTAGAGAATGCGCTGGCCGATTTTCGTCGGATGCGTAAAAAGCTCGATGGGGATATCAACAAAGAAGCGTTAGCCATTTTTGATCTGTTCACTCACTTATTGAACGATCCTATGCTGCGGAAAGATCTCAAAGCGCAGATCCAAAAAGGGGAT---CGTGCCGATTGGGCGCTGCGCCAAGTGGTCGAAAGTTATTCGAACCGTTTTGCGCGCATG...TCGGATGTTTATCTGCGAGAGCGAGCG
TRN  11011101101011000
NAM  PT1_ALCEU/5-130
ASQ  LHGIPVSRGVAIGRAHLLAPAALDVSHYL.VDEDQLDAEVERLRAARAAVRAELAALKRDLPRDAPEELGAFLDVHAMILDDEALAREPEALIRGRRYNAEWALTTRLEELMHQFDEI.EDEYLRERK
DSQ  CTGCACGGCATCCCGGTCTCGCGCGGCGTCGCCATCGGGCGCGCGCACCTGCTTGCGCCCGCGGCGCTGGACGTGTCGCACTACCTG...GTCGATGAAGACCAGCTCGACGCCGAGGTCGAACGGCTGCGCGCAGCGCGCGCCGCGGTGCGGGCGGAGCTGGCCGCGCTCAAGCGCGACCTGCCGCGCGATGCGCCCGAGGAGCTGGGCGCATTCCTGGACGTGCACGCGATGATCCTCGACGACGAGGCGCTGGCGCGCGAGCCCGAGGCCCTGATCCGGGGCCGCCGCTACAACGCAGAGTGGGCACTTACCACGCGCCTCGAAGAGCTGATGCACCAGTTCGACGAGATC...GAGGATGAATACCTGCGCGAGCGCAAG
TRN  11011111101111111
NAM  Q9JWF8_NEIMA/5-130
ASQ  LHGVAAGKGIAVGCAHLIARGTEEVPQYD.VAEADTDAEAERFDAAVKATRKELEQLRSAIPENAPTELGAFISLHLMLLTDVTLSREPVDILREQKINAEWALKQQSDKLAAQFDNM.DDAYLRERK
DSQ  CTGCACGGCGTGGCGGCGGGCAAAGGCATTGCCGTCGGTTGCGCCCACCTGATTGCGCGCGGTACGGAGGAAGTGCCGCAGTATGAT...GTTGCGGAGGCGGACACCGATGCCGAAGCCGAACGTTTCGATGCCGCCGTCAAAGCCACGCGCAAAGAGTTGGAACAGCTCCGCAGCGCGATTCCCGAAAACGCCCCGACCGAGTTGGGCGCGTTCATCTCGCTGCACCTGATGCTCTTGACCGATGTTACCTTGTCGCGCGAACCCGTCGATATTTTAAGGGAACAAAAAATCAACGCCGAGTGGGCATTGAAGCAGCAGAGCGACAAACTCGCCGCCCAATTCGACAATATG...GACGATGCCTATTTGCGCGAACGCAAG
TRN  10010101100011010
NAM  Q9PDH7_XYLFA/20-143
ASQ  LQGHGAARGAALGRAWVRQMNVMEIQDKY.--ITDTNAELHSLYQAMSAARQEIQVLRERMHGTLSHEVGEFLDLHTLLIDDPELLRSPNELILTHNYSAEYALKIQRDRLTTEFEAM.EDHYLKSRM
DSQ  CTCCAGGGCCACGGCGCAGCACGAGGTGCTGCACTGGGGCGCGCCTGGGTCCGTCAGATGAACGTCATGGAAATCCAGGATAAATAC...------ATCACTGACACTAACGCCGAATTACATAGCTTGTACCAAGCCATGAGCGCAGCGCGTCAGGAAATACAAGTACTGCGAGAACGCATGCATGGCACCTTGTCCCACGAAGTCGGCGAGTTTCTCGACCTACACACACTGTTGATCGACGACCCGGAGCTACTACGGAGCCCGAACGAACTCATCCTCACTCACAACTACAGTGCCGAATACGCCCTGAAAATACAGCGCGACCGCCTCACCACAGAATTCGAAGCCATG...GAAGACCACTACCTGAAAAGTCGCATG
TRN  10010101100011010
NAM  Q8P705_XANCP/5-130
ASQ  LRGHAASRGNALGRARVRQSHTLEVAEQR.VPANQVETQLQRLHAAIAAARTEMQQLRDRLHGALAREVGEFLELHALLLDDPELLQGLDDLIRTHRYSADYALRVQRDRLAAVFDGM.EDAYLRSRM
DSQ  TTGCGCGGACATGCCGCCTCGCGCGGTAACGCATTGGGGCGCGCCCGCGTCCGCCAGAGCCACACACTGGAGGTGGCCGAGCAACGC...GTGCCGGCCAACCAGGTCGAAACGCAGCTGCAGCGTCTGCACGCGGCCATTGCCGCCGCACGCACCGAGATGCAGCAACTGCGCGACCGCCTGCATGGCGCGCTGGCCCGCGAAGTGGGCGAATTCCTCGAACTGCACGCGCTGTTACTGGACGACCCGGAACTGCTGCAGGGGCTAGACGATCTGATTCGCACGCACCGCTACAGCGCCGACTACGCGCTGCGCGTGCAACGCGATCGTCTGGCGGCGGTGTTCGACGGCATG...GAAGATGCCTACCTGCGCAGCCGCATG
TRN  11011111101111110
NAM  Q8U8B9_AGRT5/183-304
ASQ  IDGDAYGEGIGLGHVVLHDPRIVVTNLLN.---EDADTEIRRLADAIGSLRLSIDDMLQRRDVPTEGEHREVLETYRMFAHDQGWVRRMEEAIRNGL-TAEAAVEKVQSDTKARMMRL.TDPYLRERM
DSQ  ATCGATGGCGATGCCTACGGCGAAGGCATCGGCCTTGGTCATGTCGTGCTGCATGACCCCCGAATCGTCGTCACCAATCTTCTGAAC...---------GAGGATGCGGATACGGAAATCCGGCGTCTTGCCGATGCCATCGGTTCGCTGCGGCTCTCCATCGACGACATGTTGCAGCGCCGCGACGTGCCTACGGAAGGCGAACATCGCGAAGTTCTGGAAACCTACCGCATGTTCGCCCACGATCAGGGTTGGGTGCGGCGCATGGAAGAGGCGATCCGCAACGGCCTG---ACGGCGGAAGCCGCGGTCGAGAAGGTGCAGAGCGACACCAAGGCGCGCATGATGCGCCTG...ACCGATCCCTATCTGCGCGAGCGCATG
TRN  11011111101111111
NAM  Q8YJ96_BRUME/183-304
ASQ  VSGHGFNDGIGLGHVVLHEPRIVVTNLFN.---EDSQAELNRLDEALGSLRISIDDMLSRRDVAVEGEHREVLEAYRMFAHDRGWVRRLEEAVHNGL-TAEAAVEKVQSDTRARMVHL.TDPYMRERL
DSQ  GTAAGCGGCCACGGTTTCAACGATGGTATCGGGCTTGGCCATGTGGTGCTGCATGAGCCGCGCATCGTCGTGACCAATCTTTTCAAT...---------GAGGACAGTCAGGCCGAACTCAACCGGCTGGACGAGGCGCTCGGCTCCTTGCGTATTTCCATCGATGACATGTTGTCGCGCCGCGATGTGGCGGTGGAGGGCGAGCATCGCGAGGTGCTGGAAGCCTATCGCATGTTCGCGCATGATCGCGGCTGGGTGCGTCGTCTGGAAGAAGCGGTTCATAACGGCCTT---ACGGCAGAAGCTGCCGTGGAAAAGGTGCAGAGCGACACGCGCGCGCGCATGGTGCATCTG...ACCGACCCCTATATGCGCGAGCGCCTT
TRN  11011111101111111
//