EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05521 - Phage_H_T_join)
FAM  PF05521
PID  Phage_H_T_join
DES  Phage head-tail joining protein
IPR  IPR008767
ANO  4
ALN  113
AID  0.400931
APH  ((Q9AZS5_9CAUD/2-113:0.80204,Q9AZM0_9CAUD/1-111:0.42332):0.87942,O64288_9CAUD/3-113:0.09602,O64277_9CAUD/3-113:0.14924);
ATP  ((Q9AZS5_9CAUD/2-113,Q9AZM0_9CAUD/1-111),O64288_9CAUD/3-113,O64277_9CAUD/3-113);
ATL  2.35002
DNO  4
DLN  339
DID  0.515056
DPH  (O64288_9CAUD/3-113:0.07931,(Q9AZS5_9CAUD/2-113:0.54753,Q9AZM0_9CAUD/1-111:0.28192):0.63115,O64277_9CAUD/3-113:0.15412);
DTP  (O64288_9CAUD/3-113,(Q9AZS5_9CAUD/2-113,Q9AZM0_9CAUD/1-111),O64277_9CAUD/3-113);
DTL  1.69403
RID  0.400931
RPH  ((Q9AZS5_9CAUD/2-113:0.80204,Q9AZM0_9CAUD/1-111:0.42332):0.87942,O64288_9CAUD/3-113:0.09602,O64277_9CAUD/3-113:0.14924);
RTP  ((Q9AZS5_9CAUD/2-113,Q9AZM0_9CAUD/1-111),O64288_9CAUD/3-113,O64277_9CAUD/3-113);
RTL  2.35002
LNK  O64277_9CAUD/3-113:O64277:AF115103
LNK  O64288_9CAUD/3-113:O64288:AF115102
LNK  Q9AZM0_9CAUD/1-111:Q9AZM0:AF323670
LNK  Q9AZS5_9CAUD/2-113:Q9AZS5:AF323669
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  O64277_9CAUD/3-113
ASQ  KVKYLPSDFPYKADFGTYQSTPNKFTGVSVPKF--VKQFTLHYQPHIRTLNQEYLAQQNGEDDTRVIVIRHNSKVIEGQVVVLHGTQYDIIRASSNENFGINRYDFLPVRQRK
DSQ  AAAGTTAAATATTTACCCTCTGATTTTCCATATAAAGCTGATTTTGGCACATATCAAAGTACACCCAATAAATTCACTGGCGTGAGCGTACCAAAATTT------GTTAAACAGTTTACATTGCATTACCAACCACACATACGCACACTCAATCAAGAGTACCTAGCTCAACAGAATGGCGAAGATGATACAAGGGTGATTGTTATTCGTCATAACTCAAAAGTGATTGAAGGTCAAGTTGTCGTTTTACATGGAACTCAATATGATATTATTCGTGCTAGCTCAAACGAAAACTTTGGGATTAATCGCTACGACTTCCTACCTGTGAGACAGAGAAAG
TRN  10010101110011000
NAM  O64288_9CAUD/3-113
ASQ  RGRYLPSDFRYKADFGTYQSTPNKFTGVSVPKF--VKQFTLHYKPHTRTLNQEYLAIQNGENDTRVIVIRHNAKVLEGQVVTLNGTQYDIVRISPDDNFGFNHYDFLTLKKRK
DSQ  AGAGGTAGATATTTACCATCAGACTTTCGTTATAAAGCAGATTTTGGTACATATCAAAGCACACCCAACAAATTCACTGGAGTGAGTGTTCCAAAATTT------GTTAAACAATTTACGCTGCATTATAAACCACACACCCGAACGCTCAATCAAGAGTATTTAGCTATTCAAAATGGTGAAAATGATACACGAGTGATTGTTATTCGCCACAATGCAAAAGTATTAGAAGGTCAAGTTGTCACTTTAAACGGAACTCAATATGACATCGTGCGTATCAGTCCAGACGATAACTTTGGTTTTAACCACTACGACTTTCTAACTTTGAAAAAGCGTAAG
TRN  10010101100011000
NAM  Q9AZS5_9CAUD/2-113
ASQ  VKTYKPNDFNRKCKIGVTKTVTVP-SGGKIEKIDPATVLNVRFAAKMRSLALQFQIIGTTTADTFDIAIRHNKLVTKKMFVQIDDVLYNIINISSDESAKLIKFDILTLQAKK
DSQ  GTCAAAACTTACAAACCGAATGATTTTAACAGAAAATGTAAGATTGGAGTTACTAAAACAGTAACGGTTCCA---AGTGGAGGCAAGATTGAAAAAATTGACCCAGCAACGGTTTTAAATGTTCGATTTGCGGCTAAAATGAGATCACTTGCGCTTCAATTTCAGATAATTGGTACAACTACGGCTGATACATTCGACATTGCAATTAGACATAATAAGCTAGTTACAAAGAAAATGTTTGTTCAAATAGATGATGTTCTTTACAATATTATTAATATTTCTTCGGATGAATCTGCAAAGCTTATTAAATTTGATATTTTGACTCTTCAAGCGAAGAAG
TRN  10010101110011000
NAM  Q9AZM0_9CAUD/1-111
ASQ  MAQLNLADFNKKVQLGDVKTLTNEYTGAGYDSF--VPKINVWFASKTRTLSQSYQLQGTALENSRTIIIRHNSSAEKLKAAVIDNVQYDIVNYSPDETSNIIRYDYLTLKRSS
DSQ  ATGGCACAACTTAATCTAGCTGACTTTAACAAAAAAGTTCAACTAGGAGATGTTAAAACTTTAACTAATGAATATACAGGAGCTGGTTATGACAGTTTT------GTTCCGAAAATAAATGTTTGGTTTGCATCTAAAACAAGAACGTTGAGTCAATCATACCAACTCCAAGGAACTGCTCTTGAAAACTCACGTACGATTATCATACGACACAATTCATCAGCAGAAAAATTAAAGGCTGCTGTGATTGATAATGTCCAATATGATATCGTCAATTATTCGCCTGATGAAACAAGTAATATCATCAGGTATGATTATTTGACGCTCAAAAGGAGTTCA
TRN  10010101110011000
//