EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05480 - Staph_haemo)
FAM  PF05480
PID  Staph_haemo
DES  Staphylococcus haemolytic protein
IPR  IPR008846
ANO  8
ALN  43
AID  0.55677
APH  ((((O88157_STAEP/1-43:0.04812,(GGI2_STAHA/1-43:0.36205,GGI1_STAHA/1-43:0.20775):0.11499):0.13118,GGI3_STAHA/1-43:0.18227):0.03957,(Q8NX40_STAAW/1-43:0.31249,Q8NX39_STAAW/1-43:0.12576):0.06429):0.72995,P95769_STALU/1-43:0.17711,P95770_STALU/1-43:0.09718);
ATP  ((((O88157_STAEP/1-43,(GGI2_STAHA/1-43,GGI1_STAHA/1-43)),GGI3_STAHA/1-43),(Q8NX40_STAAW/1-43,Q8NX39_STAAW/1-43)),P95769_STALU/1-43,P95770_STALU/1-43);
ATL  2.63149
DNO  5
DLN  129
DID  0.621705
DPH  ((Q8NX40_STAAW/1-43:0.27219,Q8NX39_STAAW/1-43:0.16396):0.08263,O88157_STAEP/1-43:0.14670,(P95769_STALU/1-43:0.11651,P95770_STALU/1-43:0.09564):0.36415);
DTP  ((Q8NX40_STAAW/1-43,Q8NX39_STAAW/1-43),O88157_STAEP/1-43,(P95769_STALU/1-43,P95770_STALU/1-43));
DTL  1.24178
RID  0.53775
RPH  ((Q8NX40_STAAW/1-43:0.35284,Q8NX39_STAAW/1-43:0.08220):0.10284,O88157_STAEP/1-43:0.16293,(P95769_STALU/1-43:0.17965,P95770_STALU/1-43:0.09401):0.75522);
RTP  ((Q8NX40_STAAW/1-43,Q8NX39_STAAW/1-43),O88157_STAEP/1-43,(P95769_STALU/1-43,P95770_STALU/1-43));
RTL  1.72969
LNK  GGI1_STAHA/1-43:P11697:
LNK  GGI2_STAHA/1-43:P11698:
LNK  GGI3_STAHA/1-43:P11699:
LNK  O88157_STAEP/1-43:O88157:AF068633
LNK  P95769_STALU/1-43:P95769:U73444
LNK  P95770_STALU/1-43:P95770:U73444
LNK  Q8NX39_STAAW/1-43:Q8NX39:BA000033
LNK  Q8NX40_STAAW/1-43:Q8NX40:BA000033
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q8NX39_STAAW/1-43
ASQ  MTGLAEAIANTVQAAQQHDSVKLGTSIVDIVANGVGLLGKLFG
DSQ  ATGACTGGACTAGCAGAAGCAATCGCAAATACTGTGCAAGCTGCACAACAACATGATAGTGTGAAATTAGGCACAAGTATCGTAGACATCGTTGCTAACGGTGTGGGTTTACTAGGTAAATTATTTGGA
TRN  11011101111011010
NAM  Q8NX40_STAAW/1-43
ASQ  MEGLFNAIKDTVTAAINNDGAKLGTSIVSIVENGVGLLGKLFG
DSQ  ATGGAAGGTTTATTTAACGCAATTAAAGATACCGTAACTGCAGCAATTAATAATGATGGCGCAAAATTAGGCACAAGCATTGTGAGCATCGTTGAAAATGGCGTAGGTTTATTAGGTAAATTATTCGGA
TRN  11111101111011010
NAM  GGI3_STAHA/1-43
ASQ  MSKLVQAISDAVQAQQNQDWAKLGTSIVGIVENGVGILGKLFG
NAM  O88157_STAEP/1-43
ASQ  MSKLAEAIANTVKAAQDQDWTKLGTSIVDIVESGVSVLGKIFG
DSQ  ATGTCAAAATTAGCAGAAGCTATTGCAAATACAGTAAAAGCAGCACAAGACCAAGATTGGACTAAATTAGGAACTAGTATCGTTGATATCGTAGAAAGTGGCGTTAGCGTATTAGGTAAAATCTTCGGT
TRN  11111101111011000
NAM  GGI1_STAHA/1-43
ASQ  MQKLAEAIAAAVSAGQDKDWGKMGTSIVGIVENGITVLGKIFG
NAM  GGI2_STAHA/1-43
ASQ  MEKIANAVKSAIEAGQNQDWTKLGTSILDIVSNGVTELSKIFG
NAM  P95770_STALU/1-43
ASQ  MSGIIEAITKAVQAGLDKDWATMGTSIAEALAKGIDAISGLFG
DSQ  ATGTCAGGTATCATTGAAGCAATTACTAAAGCAGTACAAGCAGGTTTAGATAAAGATTGGGCTACAATGGGCACTAGCATTGCAGAAGCACTTGCTAAAGGCATTGACGCAATTTCAGGCTTATTTGGT
TRN  11011101111011000
NAM  P95769_STALU/1-43
ASQ  MSGIVDAITKAVQAGLDKDWATMATSIADAIAKGVDFIAGFFN
DSQ  ATGTCAGGTATCGTAGATGCAATTACTAAAGCAGTACAAGCAGGTTTAGATAAAGATTGGGCTACAATGGCTACAAGCATTGCTGATGCAATCGCTAAAGGTGTAGACTTTATCGCTGGTTTCTTTAAC
TRN  11111101111011000
//