EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05472 - Ter)
FAM  PF05472
PID  Ter
DES  DNA replication terminus site-binding protein (Ter protein)
IPR  IPR008865
ANO  6
ALN  312
AID  0.435138
APH  ((TUS_ECOLI/8-309:0.12412,TUS_SALTI/8-309:0.12134):0.09989,TUS_KLEPO/8-309:0.19830,((Q8L2D8_PROVU/1-289:0.46624,Q9FA33_9ZZZZ/1-291:0.36461):1.17867,TUS_YERPE/8-309:0.42422):0.14721);
ATP  ((TUS_ECOLI/8-309,TUS_SALTI/8-309),TUS_KLEPO/8-309,((Q8L2D8_PROVU/1-289,Q9FA33_9ZZZZ/1-291),TUS_YERPE/8-309));
ATL  3.12462
DNO  6
DLN  936
DID  0.499745
DPH  (TUS_SALTI/8-309:0.17117,TUS_ECOLI/8-309:0.15965,(((Q8L2D8_PROVU/1-289:0.42435,Q9FA33_9ZZZZ/1-291:0.31686):0.63779,TUS_YERPE/8-309:0.36154):0.14093,TUS_KLEPO/8-309:0.20753):0.08508);
DTP  (TUS_SALTI/8-309,TUS_ECOLI/8-309,(((Q8L2D8_PROVU/1-289,Q9FA33_9ZZZZ/1-291),TUS_YERPE/8-309),TUS_KLEPO/8-309));
DTL  2.5049
RID  0.435138
RPH  ((TUS_ECOLI/8-309:0.12412,TUS_SALTI/8-309:0.12134):0.09989,TUS_KLEPO/8-309:0.19830,((Q8L2D8_PROVU/1-289:0.46624,Q9FA33_9ZZZZ/1-291:0.36461):1.17867,TUS_YERPE/8-309:0.42422):0.14721);
RTP  ((TUS_ECOLI/8-309,TUS_SALTI/8-309),TUS_KLEPO/8-309,((Q8L2D8_PROVU/1-289,Q9FA33_9ZZZZ/1-291),TUS_YERPE/8-309));
RTL  3.12462
LNK  Q8L2D8_PROVU/1-289:Q8L2D8:AP004237
LNK  Q9FA33_9ZZZZ/1-291:Q9FA33:AF039836
LNK  TUS_ECOLI/8-309:P16525:D90037
LNK  TUS_KLEPO/8-309:O52715:AF045243
LNK  TUS_SALTI/8-309:Q8Z6R7:AL627271
LNK  TUS_YERPE/8-309:Q9L6X9:AF231032
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  TUS_SALTI/8-309
ASQ  ERLNGTFRQIEQHLAALSDNLQQHSLLIASVFSLPQVTKEAEHAPLDTIEVTQHLGKEAEALALRHYRHLFIQQQSENRSSKAAVRLPGVLCYQVDNAT-QLDLENQVQRINQLKTTFEQMVTVESGLPSAARFEWVHRHLPGLITLNAYRTLTLINNP--ATIRFGWANKHIIKNLSRDEVLSQLKKSL--ASPRSVPPWTREQWQFKLEREYQDIAALPQQAKLKIKRPVKVQPIARIWYKGQ-----QKQVQHACPSPIIALINTDNGAGVPDIGGLENYDADNIQHRFKPQAQPLRLIIPRLHLYVAD
DSQ  GAACGCCTGAATGGCACTTTTCGCCAGATAGAACAACACCTGGCGGCGCTGTCGGATAATCTACAGCAGCATTCGCTACTTATCGCTAGTGTCTTTTCACTGCCGCAGGTGACCAAAGAGGCGGAACATGCGCCGCTGGACACTATCGAGGTCACGCAACATCTGGGGAAAGAGGCCGAAGCGCTGGCGCTACGTCACTATCGCCATTTGTTTATTCAACAGCAGTCCGAAAACCGCAGCAGTAAAGCCGCCGTCCGCCTGCCTGGCGTTTTATGCTATCAAGTGGATAATGCGACA---CAGTTAGATCTGGAAAATCAGGTACAGCGCATTAACCAGTTGAAAACCACCTTCGAGCAGATGGTTACGGTAGAGTCCGGTCTTCCCTCAGCGGCACGTTTTGAGTGGGTGCATCGGCATCTACCCGGCTTAATTACGCTGAACGCTTACCGCACGCTGACGCTTATCAATAACCCC------GCCACCATACGTTTCGGTTGGGCAAATAAACATATTATTAAAAATTTAAGCCGGGATGAGGTTCTGAGCCAGTTGAAAAAAAGCCTC------GCGTCGCCGCGCAGCGTCCCGCCGTGGACGCGCGAACAATGGCAATTCAAGCTGGAACGGGAATATCAGGATATCGCTGCCTTACCGCAGCAGGCCAAACTCAAGATTAAGCGCCCGGTTAAGGTACAGCCGATCGCCCGCATCTGGTATAAAGGCCAG---------------CAGAAACAGGTGCAACACGCCTGCCCCTCGCCGATTATCGCATTAATCAACACGGACAACGGCGCTGGCGTGCCGGATATTGGCGGGCTGGAAAACTATGACGCCGATAATATTCAGCACCGTTTTAAACCACAGGCGCAGCCGCTGCGACTGATTATTCCGCGACTGCACCTGTATGTGGCGGAT
TRN  10010101100011000
NAM  TUS_ECOLI/8-309
ASQ  DRLNTTFRQMEQELAIFAAHLEQHKLLVARVFSLPEVKKEDEHNPLNRIEVKQHLGNDAQSLALRHFRHLFIQQQSENRSSKAAVRLPGVLCYQVDNLS-QAALVSHIQHINKLKTTFEHIVTVESELPTAARFEWVHRHLPGLITLNAYRTLTVLHDP--ATLRFGWANKHIIKNLHRDEVLAQLEKSL--KSPRSVAPWTREEWQRKLEREYQDIAALPQNAKLKIKRPVKVQPIARVWYKGD-----QKQVQHACPTPLIALINRDNGAGVPDVGELLNYDADNVQHRYKPQAQPLRLIIPRLHLYVAD
DSQ  GACCGACTCAACACTACCTTTCGCCAGATGGAACAAGAGCTGGCTATATTTGCCGCTCATCTTGAGCAACACAAGCTATTGGTTGCCCGCGTGTTCTCTTTGCCGGAGGTAAAAAAAGAGGATGAGCATAATCCGCTTAATCGTATTGAGGTAAAACAACATCTCGGCAACGACGCGCAGTCGCTGGCGTTGCGTCATTTCCGCCATTTATTTATTCAACAACAGTCCGAAAATCGCAGCAGCAAGGCCGCTGTCCGTCTGCCTGGCGTGTTGTGTTACCAGGTCGATAACCTTTCG---CAAGCAGCGTTGGTCAGTCATATTCAGCACATCAATAAACTCAAGACCACGTTCGAGCATATCGTCACGGTTGAATCAGAACTCCCCACCGCGGCACGTTTTGAATGGGTGCATCGTCATTTGCCGGGGCTGATCACCCTTAATGCTTACCGCACGCTCACCGTTCTGCACGACCCC------GCCACTTTACGCTTTGGTTGGGCTAATAAACATATCATTAAGAATTTACATCGTGATGAAGTCCTGGCACAGCTGGAAAAAAGCCTG------AAATCACCACGCAGTGTCGCACCGTGGACGCGCGAGGAGTGGCAAAGAAAACTGGAGCGAGAGTATCAGGATATCGCTGCCCTGCCACAGAACGCGAAGTTAAAAATCAAACGTCCGGTGAAGGTGCAGCCGATTGCCCGCGTCTGGTACAAAGGAGAT---------------CAAAAACAAGTCCAACACGCCTGCCCTACACCACTGATTGCACTGATTAATCGGGATAATGGCGCGGGCGTGCCGGACGTTGGTGAGTTGTTAAATTACGATGCCGACAATGTGCAGCACCGTTATAAACCTCAGGCGCAGCCGCTTCGTTTGATCATTCCACGGCTGCACCTGTATGTTGCAGAT
TRN  10010101100011000
NAM  TUS_KLEPO/8-309
ASQ  ERLNNTFRQIELELQALQQALSDCRLLAGRVFELPAIGKDAEHDPLATIPVVQHIGKTALARALRHYSHLFIQQQSENRSSKAAVRLPGAICLQVTAAE-QQDLLARIQHINALKATFEKIVTVDSGLPPTARFEWVHRHLPGLITLSAYRTLTPLVDP--STIRFGWANKHVIKNLTRDQVLMMLEKSL--QAPRAVPPWTREQWQSKLEREYQDIAALPQRARLKIKRPVKVQPIARVWYAGE-----QKQVQYACPSPLIALMSGSRGVSVPDIGELLNYDADNVQYRYKPEAQSLRLLIPRLHLWLAS
DSQ  GAACGTCTGAATAATACCTTTCGCCAGATCGAGCTGGAGCTGCAGGCGCTCCAGCAGGCGTTAAGTGACTGCCGTCTGCTGGCGGGCCGGGTATTTGAACTGCCGGCGATCGGTAAGGATGCCGAGCACGATCCGCTGGCCACTATTCCGGTGGTGCAGCACATCGGCAAGACGGCCCTGGCGCGCGCCCTGCGCCACTACAGCCATCTGTTTATCCAGCAGCAATCGGAAAACCGCAGCAGCAAGGCCGCCGTACGCCTGCCGGGGGCTATCTGCCTGCAGGTTACCGCCGCGGAG---CAGCAGGATCTGCTGGCGCGTATTCAGCATATCAATGCCCTGAAGGCCACCTTCGAGAAGATCGTCACCGTCGACTCCGGCCTGCCCCCCACCGCCCGTTTTGAGTGGGTACACCGTCATTTGCCGGGGTTGATCACCCTTAGCGCCTACCGCACGCTGACGCCCCTCGTCGACCCG------AGCACCATCCGCTTCGGCTGGGCCAATAAGCACGTCATCAAGAATCTGACCCGCGACCAGGTGTTGATGATGCTGGAGAAAAGCCTG------CAAGCGCCGCGGGCGGTGCCGCCGTGGACCCGGGAGCAGTGGCAGAGCAAACTGGAAAGGGAGTATCAGGATATCGCCGCCCTGCCGCAGCGGGCGCGGCTGAAAATAAAACGACCGGTGAAAGTCCAGCCGATCGCCCGCGTCTGGTACGCCGGCGAG---------------CAGAAACAGGTACAGTACGCCTGCCCCAGCCCGCTGATCGCCCTGATGTCCGGCAGCCGGGGGGTCAGCGTACCGGATATTGGCGAGCTGCTGAACTATGATGCCGACAATGTGCAGTATCGCTACAAACCGGAGGCGCAGTCGCTGAGATTGCTTATCCCGCGCCTGCACCTCTGGCTGGCTAGC
TRN  10010101100011010
NAM  TUS_YERPE/8-309
ASQ  ERMNTRFAELEVTLHQLHQQLDDLPLIAARVFSLPEIEKGTEHQPIEQITVNITEGEHAKKLGLQHFQRLFLHHQGQHVSSKAALRLPGVLCFSVTDKE-LIECQDIIKKTNQLKAELEHIITVESGLPSEQRFEFVHTHLHGLITLNTYRTITPLINP--SSVRFGWANKHIIKNVTREDILLQLEKSL--NAGRAVPPFTREQWRELISLEINDVQRLPEKTRLKIKRPVKVQPIARVWYQEQ-----QKQVQHPCPMPLIAFCQHQLGAELPKLGELTDYDVKHIKHKYKPDAKPLRLLVPRLHLYVEL
DSQ  GAACGAATGAATACTCGCTTTGCTGAGTTAGAAGTAACACTTCATCAACTCCACCAGCAATTGGACGATTTACCTCTAATTGCTGCCAGAGTATTTTCTCTCCCTGAAATAGAAAAAGGCACTGAGCATCAACCCATTGAGCAAATTACCGTCAATATAACCGAGGGTGAACACGCCAAAAAGTTGGGGTTACAACATTTCCAACGATTGTTTCTTCATCACCAAGGGCAGCATGTTAGCAGTAAAGCAGCACTACGCTTACCTGGCGTGCTCTGCTTCTCCGTGACCGACAAAGAA---CTCATTGAATGCCAAGATATAATAAAAAAAACCAATCAGTTAAAAGCTGAGTTAGAACATATTATTACTGTGGAATCAGGCTTACCCAGCGAACAACGCTTTGAATTTGTTCACACACACTTACATGGCCTGATAACCCTGAATACCTACCGCACCATTACCCCATTAATCAACCCC------AGTTCAGTGCGCTTTGGCTGGGCCAACAAACACATTATTAAAAATGTGACTCGCGAAGATATATTGCTACAGCTAGAAAAAAGCCTG------AATGCTGGCCGAGCTGTTCCTCCATTTACGCGTGAGCAATGGAGGGAACTGATTAGCTTGGAAATAAATGATGTGCAGCGTTTGCCAGAAAAGACACGGCTGAAAATTAAAAGGCCCGTAAAAGTGCAGCCCATCGCAAGAGTATGGTATCAAGAACAA---------------CAAAAACAGGTACAACACCCCTGCCCCATGCCCCTGATTGCGTTCTGTCAGCATCAGTTAGGGGCCGAGCTACCGAAATTAGGCGAGTTGACCGATTATGATGTGAAGCATATCAAGCATAAATATAAGCCTGATGCGAAACCGCTACGTTTGCTGGTACCGCGCTTGCATCTTTATGTCGAACTG
TRN  10010101100011000
NAM  Q9FA33_9ZZZZ/1-291
ASQ  MDLKKTFEQLTDDLLALKMLISGSSPLFSQVSDIPPVLRGDEHLPISYVAPDHLYGHEAIQKAVDIWSDLHIKH---DFSQKSARRASGVLWFPSEDNAFTVELVRLLSQINALKKSIETHIITTYQ-TRSARFEALHNQCAGVLTLHLYRQIRWWKDEHISAVRFSWQEKESLLIPDKAELLVRMSKEGREDGKKEVP----------LALLMKQIVSVPEE-RLRIRRRLKVQPSANISFRSE-QHPTGKLTMVTAPMPFIIIQNER-----PEVKMLKIYDANERISRKRRNDKVHTEILGTFHGESIE
DSQ  ATGGATTTAAAAAAAACATTTGAACAGCTTACGGACGATTTACTCGCCCTGAAAATGCTGATCAGCGGTAGCTCGCCTCTGTTTTCCCAAGTCTCCGACATTCCGCCCGTCCTGCGGGGGGATGAGCATTTACCCATTTCGTATGTTGCCCCTGATCACCTGTACGGCCATGAGGCCATTCAGAAGGCGGTTGATATCTGGAGTGACCTGCACATCAAGCAT---------GATTTTTCCCAGAAGTCTGCACGTCGTGCATCCGGTGTTCTGTGGTTTCCATCAGAAGATAATGCGTTTACGGTCGAGCTCGTTCGCCTGCTGAGCCAAATCAATGCCCTGAAAAAGAGTATTGAGACTCACATCATTACGACCTACCAG---ACACGTAGCGCACGATTTGAAGCCCTGCATAATCAATGTGCCGGGGTGCTGACTTTACATCTTTACCGTCAGATCCGCTGGTGGAAGGATGAGCATATATCAGCCGTGAGATTTAGCTGGCAAGAAAAGGAGTCTTTGCTCATTCCTGACAAAGCTGAGTTACTCGTGCGTATGAGCAAGGAAGGTAGGGAGGATGGGAAAAAAGAGGTGCCG------------------------------CTTGCGTTGCTGATGAAGCAGATCGTTTCCGTACCGGAAGAA---CGACTGCGTATAAGGCGTCGTCTCAAGGTTCAGCCATCGGCTAACATTTCGTTCCGTAGCGAG---CAACACCCGACTGGGAAGCTGACAATGGTCACGGCTCCGATGCCCTTCATTATTATTCAGAATGAACGG---------------CCAGAGGTGAAAATGCTCAAAATCTATGATGCGAATGAGCGAATCAGCCGTAAGCGACGTAACGACAAAGTGCATACGGAAATCCTCGGTACGTTTCATGGCGAAAGTATCGAA
TRN  10010101100011000
NAM  Q8L2D8_PROVU/1-289
ASQ  MNIAETFHRLEDSLALLKRVLAQKSPLYARVCVIPPVADGDETLPVNRIEPELLYGAQAIEQTQKAFTDLHIKD---GLSQKSTRRTAGVLWYDDETPEFAAEVMALITSINAIKLSIQEHIITGFS-SQNARFSALHNACPGVMTLHLYRQIRAWHKADIQSIRFSWQKKSLLRIPDKAKLLASMQADVIDNSEVTVP----------VGNLAQRIANTPQD-KLRLRRPAKIQPVANIQFRADIEGEPPTLKTVTALMPYIIIQNQR-----LEVKPLQNYSPRDIQ---RSKDRLATEVIGTFHGETIE
DSQ  ATGAACATCGCAGAAACCTTCCATCGCCTGGAAGACTCTCTGGCGTTGCTCAAGCGCGTGCTGGCACAAAAGTCGCCTCTTTATGCTCGTGTTTGTGTAATTCCGCCAGTTGCTGACGGCGATGAGACTTTACCCGTTAACCGCATCGAACCAGAATTACTGTACGGTGCCCAGGCTATTGAACAAACTCAGAAAGCCTTTACCGATCTGCATATCAAAGAC---------GGGTTATCCCAAAAATCGACACGTCGTACCGCTGGCGTGCTTTGGTATGATGATGAAACGCCTGAGTTCGCGGCAGAAGTCATGGCGCTAATAACGAGCATTAACGCAATAAAGCTGTCGATTCAAGAGCACATTATTACTGGATTCAGT---TCGCAGAATGCGCGCTTCTCCGCACTGCATAATGCCTGTCCGGGCGTAATGACGCTGCATCTATACCGGCAAATTAGAGCCTGGCATAAGGCCGATATTCAGTCCATTCGTTTCTCGTGGCAGAAGAAGTCTTTATTGCGGATCCCGGATAAGGCCAAACTACTCGCCAGCATGCAGGCCGATGTCATAGATAATAGTGAAGTGACTGTACCG------------------------------GTCGGTAATTTGGCTCAGCGGATAGCTAATACCCCGCAAGAC---AAATTACGTCTGCGTCGTCCGGCTAAAATACAGCCGGTGGCAAACATTCAGTTTCGCGCAGATATCGAAGGTGAACCGCCAACGCTGAAAACTGTAACTGCATTAATGCCATACATCATCATCCAGAATCAGCGG---------------TTAGAAGTGAAACCACTTCAGAACTATTCACCGCGCGATATTCAG---------CGAAGTAAAGACCGACTCGCAACCGAGGTGATCGGGACTTTCCACGGCGAGACTATTGAA
TRN  10010101100011000
//