EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05354 - Phage_attach)
FAM  PF05354
PID  Phage_attach
DES  Phage Head-Tail Attachment
IPR  IPR008018
ANO  3
ALN  117
AID  0.61516
APH  (O64324_BPN15/1-117:0.18795,Q8X296_ECO57/1-117:0.24375,Q8ZN00_SALTY/1-117:0.44264);
ATP  (O64324_BPN15/1-117,Q8X296_ECO57/1-117,Q8ZN00_SALTY/1-117);
ATL  0.87434
DNO  3
DLN  351
DID  0.609687
DPH  (O64324_BPN15/1-117:0.26055,Q8X296_ECO57/1-117:0.27877,Q8ZN00_SALTY/1-117:0.32295);
DTP  (O64324_BPN15/1-117,Q8X296_ECO57/1-117,Q8ZN00_SALTY/1-117);
DTL  0.86227
RID  0.61516
RPH  (O64324_BPN15/1-117:0.18795,Q8X296_ECO57/1-117:0.24375,Q8ZN00_SALTY/1-117:0.44264);
RTP  (O64324_BPN15/1-117,Q8X296_ECO57/1-117,Q8ZN00_SALTY/1-117);
RTL  0.87434
LNK  O64324_BPN15/1-117:O64324:AF064539
LNK  Q8X296_ECO57/1-117:Q8X296:BA000007
LNK  Q8ZN00_SALTY/1-117:Q8ZN00:AE008818
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  O64324_BPN15/1-117
ASQ  MADFDNLFDEAMSRADGAIRGVMGTEAKVMSGTLSGATLVGVFDDPENIGYAGAGIRVEGTSPTLFVKTSTVSQLQRMDTLTINGRQFWVDRVGPDDCGSCHIWLGNGTPPASSRRR
DSQ  ATGGCTGATTTCGATAATCTCTTTGACGAGGCCATGTCGCGAGCAGATGGTGCTATCCGTGGTGTGATGGGTACAGAGGCAAAGGTGATGTCAGGCACTTTGTCAGGTGCAACCCTGGTCGGTGTATTTGATGATCCAGAAAACATCGGTTATGCCGGCGCCGGGATTCGCGTTGAAGGTACCAGCCCGACGCTGTTTGTTAAAACCTCCACAGTCAGCCAGCTGCAGCGTATGGACACACTGACGATTAACGGGCGGCAATTCTGGGTTGATCGTGTTGGTCCTGATGATTGTGGATCATGTCACATCTGGCTGGGTAACGGCACTCCGCCAGCTTCTTCGCGCCGCCGT
TRN  11011101101011001
NAM  Q8X296_ECO57/1-117
ASQ  MADFDNLFDAAIARADETIRGYMGTSATMTSGERSGAVIRGVFDDPENISYAGQGVRVEGSSPSLFVRTDDVRQLRRGDTLTINGEMFWVDRVSPDDGGSCYLWLNRGQPPAVNRRR
DSQ  GTGGCTGATTTCGATAACCTGTTCGATGCTGCCATTGCCCGCGCCGATGAAACGATACGCGGGTACATGGGAACGTCAGCCACCATGACATCCGGTGAGCGGTCCGGCGCAGTAATACGTGGTGTTTTTGATGACCCTGAAAATATCAGCTATGCCGGACAGGGCGTGCGCGTTGAAGGCTCCAGCCCGTCCCTGTTTGTCCGGACTGATGATGTGCGGCAACTGCGGCGTGGTGACACGCTGACCATTAACGGCGAGATGTTCTGGGTGGACCGTGTTTCTCCGGATGACGGAGGGAGTTGTTATCTCTGGCTCAACCGTGGGCAACCACCGGCAGTTAACCGGCGACGA
TRN  10010111100111001
NAM  Q8ZN00_SALTY/1-117
ASQ  MSQSENLFDTAISQADDAILRVMGTVATITSGVLAGATLTGVFDDPESVSYAAGGVRIEGDKPTFFVKTSLTVHLKRPDTLTILGDTFWVDRITPAGGDSSIILLGRGTPPTDNRRR
DSQ  ATGTCGCAGTCCGAAAACCTGTTTGATACCGCGATTTCTCAGGCTGATGATGCCATCCTCCGGGTGATGGGAACGGTAGCAACAATAACCTCCGGCGTTCTGGCAGGGGCCACGCTTACGGGCGTATTTGACGATCCTGAAAGTGTGTCGTATGCCGCCGGAGGTGTCCGGATTGAGGGAGACAAGCCTACATTTTTTGTCAAAACATCCCTGACAGTCCATCTGAAGCGCCCGGACACACTAACCATTCTCGGTGACACCTTCTGGGTGGATCGCATCACTCCGGCTGGTGGAGACAGCAGTATTATTCTGCTGGGCAGGGGGACGCCGCCGACGGATAACCGGCGCAGG
TRN  10010101100011011
//