EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05352 - Phage_connector)
FAM  PF05352
PID  Phage_connector
DES  Phage Connector (GP10)
IPR  IPR008016
ANO  3
ALN  281
AID  0.639487
APH  (Q9FZW5_BPGA1/7-287:0.51601,VG10_BPPH2/8-285:0.13944,VG10_BPB03/7-284:0.15423);
ATP  (Q9FZW5_BPGA1/7-287,VG10_BPPH2/8-285,VG10_BPB03/7-284);
ATL  0.80968
DNO  3
DLN  843
DID  0.618705
DPH  (Q9FZW5_BPGA1/7-287:0.42937,VG10_BPPH2/8-285:0.19794,VG10_BPB03/7-284:0.22700);
DTP  (Q9FZW5_BPGA1/7-287,VG10_BPPH2/8-285,VG10_BPB03/7-284);
DTL  0.85431
RID  0.639487
RPH  (Q9FZW5_BPGA1/7-287:0.51601,VG10_BPPH2/8-285:0.13944,VG10_BPB03/7-284:0.15423);
RTP  (Q9FZW5_BPGA1/7-287,VG10_BPPH2/8-285,VG10_BPB03/7-284);
RTL  0.80968
LNK  Q9FZW5_BPGA1/7-287:Q9FZW5:X96987
LNK  VG10_BPB03/7-284:Q37891:X99260
LNK  VG10_BPPH2/8-285:P04332:M14782
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9FZW5_BPGA1/7-287
ASQ  SYKTIGEIQRRRGNLWFRTYQRYLFSLAYQMFEWQGLPKTVDPIFLEKQLHQRGFVAFYKDEMYGYLGVQGTLSGQINLYNQPNFYTASAPTYQKSFPLYWYDMGEDLNEKGQGIVIYNNLERMPTLDILNLYAMNLAELKETIYVNQNAQKTPVIIKAGDNDLFSMKQVYNKYEGNEPVIFAGKKFNTDDIEVLKTDAPYVADKLTMLFKDQWNEAMTFLGLSNANTDKKERLIQSEVESNNDQIQGSANIYLAPRQEACRLINEYYGLNVSVKLRKELV
DSQ  TCTTATAAGACCATAGGGGAAATACAACGAAGAAGGGGTAATCTATGGTTTAGAACCTATCAACGCTACCTTTTCTCACTTGCTTATCAGATGTTTGAATGGCAAGGACTCCCAAAAACAGTTGACCCAATTTTCCTAGAAAAACAGTTACATCAACGTGGATTCGTGGCATTTTACAAAGATGAAATGTATGGGTATCTAGGAGTTCAAGGTACATTAAGTGGTCAAATTAACTTATACAACCAACCTAACTTTTATACTGCTTCTGCTCCTACTTATCAAAAGTCCTTCCCTCTATATTGGTATGATATGGGAGAAGACTTAAACGAAAAAGGTCAGGGTATTGTTATCTATAACAACTTGGAAAGAATGCCCACTTTAGACATTTTAAATCTTTATGCTATGAATTTAGCTGAATTAAAAGAAACAATATATGTCAACCAAAACGCACAGAAAACACCTGTAATCATTAAAGCAGGGGATAATGACCTTTTCTCTATGAAACAAGTTTATAATAAATATGAGGGAAATGAGCCTGTTATCTTTGCAGGTAAAAAGTTTAACACAGATGACATAGAAGTATTAAAAACTGATGCACCTTATGTTGCGGACAAGTTAACAATGTTGTTCAAAGACCAGTGGAATGAAGCAATGACATTTCTCGGTTTATCAAACGCCAACACCGATAAAAAAGAGCGATTGATACAAAGTGAGGTAGAAAGTAATAACGATCAAATTCAAGGTTCTGCTAATATCTACCTAGCTCCTAGACAAGAAGCGTGTAGACTCATTAACGAGTATTACGGGCTTAATGTATCTGTAAAACTTAGAAAGGAGTTGGTT
TRN  10010101110011000
NAM  VG10_BPPH2/8-285
ASQ  TYRSINEIQRQKRNRWFIHYLNYLQSLAYQLFEWENLPPTINPSFLEKSIHQFGYVGFYKDPVISYIACNGALSGQRDVYNQATVFRAASPVYQKEFKLYNY---RDMKEEDMGVVIYNNDMAFPTTPTLELFAAELAELKEIISVNQNAQKTPVLIRANDNNQLSLKQVYNQYEGNAPVIFAHEALDSDSIEVFKTDAPYVVDKLNAQKNAVWNEMMTFLGIKNANLEKKERMVTDEVSSNDEQIESSGTVFLKSREEACEKINELYGLNVKVKFRYDIV
DSQ  ACATACCGATCTATCAATGAGATACAGCGTCAAAAACGGAATAGATGGTTTATTCACTATCTGAACTACCTTCAATCTCTAGCCTATCAGCTATTTGAGTGGGAGAACCTACCGCCTACGATAAACCCTAGTTTCTTAGAAAAGTCTATTCATCAATTCGGGTACGTGGGGTTCTATAAAGACCCTGTCATCAGTTATATCGCTTGTAATGGCGCTCTATCGGGTCAGAGAGACGTTTACAACCAAGCTACAGTTTTTAGAGCCGCATCTCCTGTGTATCAAAAAGAATTCAAGCTATACAACTAT---------AGAGATATGAAGGAAGAAGATATGGGTGTTGTTATCTACAACAATGACATGGCTTTCCCTACCACGCCAACGCTAGAATTGTTTGCGGCTGAATTGGCTGAATTAAAAGAAATCATATCGGTCAACCAAAACGCTCAAAAGACACCCGTCTTAATTAGAGCCAATGACAATAACCAACTGAGCTTAAAACAAGTGTATAACCAGTATGAAGGTAATGCCCCTGTTATCTTCGCTCACGAAGCTCTCGACAGTGACTCTATAGAAGTGTTTAAGACTGATGCTCCCTATGTGGTGGACAAGTTAAACGCTCAGAAAAATGCAGTATGGAATGAGATGATGACTTTCCTTGGCATTAAGAACGCTAACCTAGAGAAGAAAGAGCGCATGGTTACGGATGAAGTTTCCAGTAACGATGAACAGATCGAGTCTAGCGGCACTGTATTTTTGAAGTCGAGGGAAGAAGCATGTGAGAAGATTAATGAGCTATATGGTCTCAATGTTAAAGTTAAATTCAGATATGACATCGTG
TRN  10010101100011010
NAM  VG10_BPB03/7-284
ASQ  SYKSINDIQRMRGNRWYYHYYQYLCSLAYQLFEWERLPPSVDPSYLEKSIHQFGYVGFYKDPRIGYIACQGALSGTVDHYNLPDRFHASSVGYQNTFKLYNY---SDMKEKNMGVAIYNNDLKCSTLPALEMFAQDLAELKEIIAVNQNAQKTPVLIAANDNNQLSLKNIYNQYEGNAPVIFVHESLDLDNLKVFKTDAPYVVDKLNAQKNAVWNEVMTYLGIKNANLEKKERMVTSEVDSNDEQIESSGNIYLKARQEACNKISELYGLNLKVKFRYDIV
DSQ  AGTTACAAATCAATAAACGACATCCAACGTATGCGTGGCAACCGCTGGTACTACCACTATTACCAGTACCTTTGTTCTCTAGCGTATCAACTTTTTGAATGGGAAAGGCTACCGCCTAGTGTAGACCCTAGCTATTTAGAAAAAAGCATTCACCAGTTTGGGTATGTTGGTTTTTATAAAGATCCACGCATTGGTTATATTGCGTGTCAAGGCGCACTGTCAGGGACAGTTGATCATTATAATTTACCTGACCGCTTCCACGCATCATCAGTTGGATACCAAAACACATTTAAACTTTATAACTAC---------AGTGATATGAAAGAAAAGAACATGGGTGTTGCCATTTACAACAACGATCTAAAGTGTTCAACCCTTCCTGCATTAGAAATGTTTGCTCAGGATTTAGCAGAGTTGAAAGAAATTATTGCTGTTAACCAGAATGCACAGAAAACCCCTGTTCTTATTGCGGCAAACGACAACAACCAACTGAGTCTGAAAAATATTTACAATCAATATGAGGGAAATGCCCCTGTTATCTTTGTTCACGAATCACTTGACTTAGATAACTTGAAGGTGTTTAAAACAGATGCCCCATATGTTGTTGATAAATTGAATGCTCAGAAAAACGCTGTCTGGAATGAGGTTATGACGTATCTAGGCATCAAAAACGCAAATCTCGAAAAGAAAGAAAGAATGGTCACAAGTGAAGTAGACAGCAACGATGAGCAGATTGAAAGTAGTGGCAACATTTATTTGAAAGCCCGTCAAGAAGCTTGCAACAAAATAAGTGAGCTGTATGGACTCAACCTCAAAGTTAAATTCAGATACGACATTGTG
TRN  10010101100011000
//