EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05348 - UMP1)
FAM  PF05348
PID  UMP1
DES  Proteasome maturation factor UMP1
IPR  IPR008012
ANO  7
ALN  134
AID  0.270908
APH  ((((Q8MPE9_TAESO/8-138:1.23767,Q9VIJ5_DROME/5-133:0.76263):0.15270,Q9CQT5_MOUSE/13-141:0.42756):0.19610,(UMP1_SCHPO/3-129:0.88493,UMP1_YEAST/18-148:0.72589):0.69332):0.74161,O65048_PICMA/4-132:0.22601,Q94B05_ARATH/3-132:0.29781);
ATP  ((((Q8MPE9_TAESO/8-138,Q9VIJ5_DROME/5-133),Q9CQT5_MOUSE/13-141),(UMP1_SCHPO/3-129,UMP1_YEAST/18-148)),O65048_PICMA/4-132,Q94B05_ARATH/3-132);
ATL  6.3579
DNO  7
DLN  402
DID  0.38502
DPH  ((Q8MPE9_TAESO/8-138:0.68538,(UMP1_SCHPO/3-129:0.59076,UMP1_YEAST/18-148:0.69579):0.22423):0.11001,(Q9CQT5_MOUSE/13-141:0.31319,Q9VIJ5_DROME/5-133:0.60012):0.16539,(O65048_PICMA/4-132:0.25969,Q94B05_ARATH/3-132:0.24785):0.50795);
DTP  ((Q8MPE9_TAESO/8-138,(UMP1_SCHPO/3-129,UMP1_YEAST/18-148)),(Q9CQT5_MOUSE/13-141,Q9VIJ5_DROME/5-133),(O65048_PICMA/4-132,Q94B05_ARATH/3-132));
DTL  4.40036
RID  0.270908
RPH  ((((Q8MPE9_TAESO/8-138:1.23767,Q9VIJ5_DROME/5-133:0.76263):0.15270,Q9CQT5_MOUSE/13-141:0.42756):0.19610,(UMP1_SCHPO/3-129:0.88493,UMP1_YEAST/18-148:0.72589):0.69332):0.74161,O65048_PICMA/4-132:0.22601,Q94B05_ARATH/3-132:0.29781);
RTP  ((((Q8MPE9_TAESO/8-138,Q9VIJ5_DROME/5-133),Q9CQT5_MOUSE/13-141),(UMP1_SCHPO/3-129,UMP1_YEAST/18-148)),O65048_PICMA/4-132,Q94B05_ARATH/3-132);
RTL  6.3579
LNK  O65048_PICMA/4-132:O65048:AF051205
LNK  Q8MPE9_TAESO/8-138:Q8MPE9:AJ428459
LNK  Q94B05_ARATH/3-132:Q94B05:AY044313
LNK  Q9CQT5_MOUSE/13-141:Q9CQT5:AK014296
LNK  Q9VIJ5_DROME/5-133:Q9VIJ5:AE003668
LNK  UMP1_SCHPO/3-129:O74416:AL031518
LNK  UMP1_YEAST/18-148:P38293:AJ002557
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  UMP1_YEAST/18-148
ASQ  DKSVLSSAVPSLPDTLRQQEGGAVPLSTQLNDRHPLESTLKN-WETTQRQRQMEQYRQIFGIAEPMKRTMEMEIVNRTDFNP-LSTNGSIHRDILLNKECSIDWEDVYPGTGLQASTMVgDDVHSKIEKQLGI-
DSQ  GACAAAAGTGTTCTTTCATCTGCAGTGCCCTCCTTGCCAGACACATTACGCCAGCAAGAAGGCGGTGCAGTACCTCTTTCCACACAATTGAATGACAGACATCCATTAGAATCAACATTGAAGAAC---TGGGAAACCACACAGCGCCAAAGACAAATGGAACAGTATCGACAAATATTTGGCATTGCCGAACCAATGAAAAGGACGATGGAAATGGAAATCGTCAATCGTACCGACTTCAACCCC---CTTTCAACAAACGGTAGTATACACCGTGACATACTACTGAACAAAGAGTGCAGCATCGATTGGGAGGACGTCTACCCTGGTACTGGCCTACAAGCCAGCACCATGGTAggtGATGACGTCCACAGCAAAATCGAAAAACAATTAGGCATT---
TRN  10010101100011000
NAM  UMP1_SCHPO/3-129
ASQ  IVPDVEPAAEVSGNFKVSVLEPSIPAVHRVENKHPLESRLKN-WEAQQQQIRLDSMRRIYGLHEPVRREMEQKLASQSSRPLALGGSANFHLDILANREAVLDETDIYAAPIPLEMTY-.---QNEMAIRYGL-
DSQ  ATTGTTCCTGACGTCGAACCAGCTGCTGAAGTATCTGGAAACTTCAAAGTCTCAGTTTTAGAGCCCAGCATTCCAGCTGTACACCGTGTTGAAAATAAACATCCTCTAGAAAGTCGATTAAAGAAT---TGGGAGGCTCAACAGCAACAAATTCGCCTTGATAGCATGCGTAGAATTTACGGTTTGCATGAGCCTGTGCGTCGTGAAATGGAACAGAAACTCGCTTCACAGAGCTCTCGTCCTTTGGCTTTAGGAGGATCTGCAAACTTTCATTTAGATATTCTTGCCAATCGTGAGGCTGTCCTAGACGAAACCGACATATATGCTGCCCCTATTCCTTTGGAAATGACTTAT---...---------CAAAATGAAATGGCCATTAGATATGGTCTC---
TRN  10010101110011000
NAM  Q8MPE9_TAESO/8-138
ASQ  KLSRNEFGLVSAMYNGLAANRGLISEVDAVAAPHPAAAAEAQRGEAAQRMQSMRVLRSTQGLHAPLRLAMEERVMERMAPRLPGIYTHHPLAAQLSGALDTIDFCDILNSPEDAEVMVS.--PHLLMERQQGIL
DSQ  AAACTTTCTCGCAATGAATTTGGTCTGGTTTCGGCCATGTACAATGGTCTGGCCGCCAATCGAGGCCTGATCTCAGAGGTAGACGCAGTAGCTGCGCCACATCCAGCAGCAGCAGCTGAAGCGCAACGCGGAGAGGCGGCACAACGAATGCAGTCGATGCGTGTTCTTCGCTCCACTCAGGGTCTGCATGCACCCTTACGACTGGCCATGGAGGAGAGAGTAATGGAACGCATGGCGCCCCGTCTTCCCGGCATCTATACTCACCATCCACTGGCTGCGCAACTCAGCGGTGCTCTTGATACAATCGACTTTTGTGACATTCTAAATAGCCCTGAGGACGCCGAGGTGATGGTCTCG...------CCGCATCTGCTAATGGAGCGTCAACAAGGCATTCTG
TRN  10010101100011000
NAM  Q9VIJ5_DROME/5-133
ASQ  SLKVQPAEVSVLNATGRVGMPTEANCLNQLAHVHRLRDSELN-YNEHQYNRNMQMLRNHEGLGVPLKMGMERFAARQVGRLP-FLSSSNFMDDVLTGRCDSIGFEDFMNLPENSEHMR-.-QPHAVVEKSLGIY
DSQ  TCACTGAAAGTCCAGCCCGCCGAGGTGTCCGTGCTGAACGCCACCGGCCGTGTGGGAATGCCCACCGAGGCCAACTGCCTGAACCAACTGGCCCACGTCCACCGGCTGCGCGACTCGGAGCTGAAC---TACAACGAGCACCAGTACAACCGCAACATGCAGATGCTGCGCAACCACGAGGGCCTCGGCGTGCCCCTCAAGATGGGCATGGAGCGCTTCGCCGCACGTCAGGTGGGCCGCCTGCCC---TTCCTTTCGTCCAGCAACTTCATGGACGATGTCCTGACTGGCCGCTGTGATTCCATTGGCTTCGAGGACTTCATGAACTTGCCCGAGAACAGCGAGCATATGCGT---...---CAGCCCCACGCTGTGGTGGAGAAATCTCTGGGAATTTAC
TRN  11011101101011001
NAM  Q9CQT5_MOUSE/13-141
ASQ  SIPVAELSASGPFESHDLLRKGFSCVKNELLPSHPLELSEKN-FQLNQDKMNFSTLRNIQGLFAPLKLQMEFKAVQQVHRLP-FLPSSNLSLDILRGNDETIGFEDILNDPSQSELMG-.-EPHVMVEHKLGLL
DSQ  AGTATTCCAGTCGCGGAGCTCTCAGCCAGCGGGCCTTTCGAGAGTCACGATCTTCTCCGGAAAGGGTTTTCTTGTGTGAAAAATGAACTTTTGCCCAGTCACCCTCTCGAGTTATCAGAAAAAAAC---TTCCAGCTCAACCAGGACAAGATGAACTTTTCCACGCTGAGGAACATCCAGGGTCTGTTTGCTCCCCTGAAGTTACAGATGGAATTCAAGGCAGTGCAGCAGGTTCACCGTCTCCCG---TTTCTCCCGAGCTCAAACCTCTCACTGGATATTTTGAGGGGCAACGATGAGACCATTGGTTTTGAGGATATTCTTAATGATCCATCACAAAGTGAACTGATGGGT---...---GAGCCCCACGTGATGGTGGAACATAAGCTGGGCTTGCTG
TRN  10010101100011000
NAM  Q94B05_ARATH/3-132
ASQ  SEKKIAHEIGGVKN--DALRFGLHGVKSNIIGSHPLESSYES-EKKSKEALKRTVIAHAYGTALPLKMDMDRQILSRFQRPPGPIPSSMLGLEVYTGAVDDFGFEDYLNDPRDSETFKP.VDFHHGMEVRLGIS
DSQ  TCTGAGAAAAAGATAGCTCATGAGATCGGTGGTGTCAAAAAC------GACGCTCTTCGATTTGGTCTTCACGGCGTTAAGAGCAACATCATCGGATCTCACCCACTCGAATCGTCATACGAATCT---GAAAAGAAATCGAAAGAGGCGTTGAAGAGGACGGTCATTGCGCATGCCTACGGGACTGCACTTCCGTTGAAGATGGATATGGATAGGCAAATTCTCTCAAGGTTTCAGAGACCTCCTGGACCAATTCCGTCGTCGATGCTCGGTTTAGAAGTCTACACGGGAGCTGTGGATGACTTTGGTTTTGAGGATTACTTGAATGATCCTCGTGATTCCGAGACATTCAAGCCG...GTAGACTTCCACCACGGGATGGAAGTTCGTCTTGGCATCTCA
TRN  10010101110011000
NAM  O65048_PICMA/4-132
ASQ  VQQSLPHEIGGIT---DTLRFGLAGVKSDILISHPVQVIQEN-AQKQQREMKRNILAKTYGSAFPLKMDIEQQILSRFQRPPGELPSSMLGLESLTGSLDEFSFEDYLNDPRESETFVP.ADMHHGMEVRLGLS
DSQ  GTACAGCAATCTCTTCCACACGAAATAGGAGGTATTACC---------GATACATTGCGCTTCGGACTTGCAGGGGTTAAGAGCGACATTCTGATATCGCATCCAGTTCAAGTTATTCAGGAAAAT---GCTCAGAAGCAGCAAAGAGAAATGAAGCGTAATATTCTAGCAAAAACATATGGGTCTGCTTTTCCCTTGAAGATGGATATTGAACAACAAATTCTTTCAAGATTTCAAAGGCCTCCTGGTGAGTTGCCATCTTCGATGCTAGGTCTTGAGTCATTGACCGGTTCCTTGGATGAGTTCTCCTTCGAAGATTATTTGAATGATCCTCGGGAGTCAGAAACTTTCGTGCCT...GCAGATATGCATCATGGTATGGAAGTACGTCTAGGCCTGTCA
TRN  10010101100011001
//