EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05309 - TraE)
FAM  PF05309
PID  TraE
DES  TraE protein
IPR  IPR007973
ANO  3
ALN  195
AID  0.301822
APH  (O85947_SPHAR/1-184:1.71836,TRE1_SALTI/1-187:0.16965,Q46998_ECOLI/1-187:0.78120);
ATP  (O85947_SPHAR/1-184,TRE1_SALTI/1-187,Q46998_ECOLI/1-187);
ATL  2.66921
DNO  3
DLN  585
DID  0.431624
DPH  (O85947_SPHAR/1-184:0.99243,TRE1_SALTI/1-187:0.19605,Q46998_ECOLI/1-187:0.52458);
DTP  (O85947_SPHAR/1-184,TRE1_SALTI/1-187,Q46998_ECOLI/1-187);
DTL  1.71306
RID  0.301822
RPH  (O85947_SPHAR/1-184:1.71836,TRE1_SALTI/1-187:0.16965,Q46998_ECOLI/1-187:0.78120);
RTP  (O85947_SPHAR/1-184,TRE1_SALTI/1-187,Q46998_ECOLI/1-187);
RTL  2.66921
LNK  O85947_SPHAR/1-184:O85947:AF079317
LNK  Q46998_ECOLI/1-187:Q46998:U51859
LNK  TRE1_SALTI/1-187:P12057:M14733
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  O85947_SPHAR/1-184
ASQ  MDLSISHGQAQRLLKQRNLLAITATGLFALSVVLTFTAA-----------HRDREVVLQPVLAKPLTLSSSHIDKDYLELVTRDAALLTLNRSPSNLQYWMDSILAITDPRTHGRMKAELMKIFNEQNGSNVSQFFTIENLSVDPEALTSEVNGVLHTVVGSKEVTSEARTFRYVWSYSGVSLKLAGFGRVTKDP
DSQ  ATGGACCTCTCGATTTCTCACGGCCAGGCGCAGCGGCTCTTAAAGCAGCGCAACCTCCTCGCGATCACCGCGACCGGGCTGTTTGCCCTGAGCGTGGTGTTGACGTTCACCGCCGCG---------------------------------CACCGCGACCGCGAAGTGGTGCTGCAGCCGGTGCTGGCGAAGCCGCTGACGCTGTCCTCGAGCCACATCGACAAGGATTACCTTGAGCTCGTCACGCGCGATGCCGCGCTGCTGACACTCAACCGCTCGCCGTCCAACCTGCAGTACTGGATGGATTCGATCCTGGCGATCACCGATCCCAGAACCCACGGCCGGATGAAGGCCGAACTGATGAAGATCTTCAACGAGCAGAACGGCTCGAATGTCTCGCAGTTCTTCACGATCGAGAACCTCTCTGTCGATCCCGAGGCACTGACCAGCGAGGTCAACGGCGTGCTGCACACGGTGGTCGGCTCCAAGGAGGTGACCTCCGAAGCCCGGACCTTCCGCTACGTGTGGAGCTACTCGGGCGTCAGCCTCAAGCTCGCCGGGTTCGGGCGCGTGACCAAGGATCCG
TRN  10010101100011010
NAM  TRE1_SALTI/1-187
ASQ  MEISARNSSTK-------IIAVIILSLTTLVFILGFAVAWL-AVTNRALIHEQRTVVTPMTYNAPFVVSETKADTEYFRMMTLSFLALRLNVSPETVDSNHAFLMSFVEPEAREEFKKVLQEEAAQIKANDVNSTFYTTEINVYPVDGRIDVRGVLKMWIGNSRPSTEIKTYRLRLKYTGGFTRIGRFYEVTNEK
DSQ  ATGGAAATTAGCGCTCGTAATTCATCCACCAAA---------------------ATTATTGCCGTTATTATTCTGTCGCTCACGACACTGGTCTTTATTCTGGGCTTTGCCGTGGCATGGCTG---GCTGTGACCAACAGAGCACTCATCCACGAGCAACGTACAGTCGTCACACCGATGACCTACAACGCGCCTTTTGTGGTATCCGAAACTAAAGCCGATACCGAGTATTTCCGGATGATGACGCTGTCCTTCCTGGCCCTGCGTCTCAATGTCTCGCCTGAAACGGTCGATTCCAACCACGCTTTTCTGATGTCTTTTGTCGAACCAGAGGCCCGGGAGGAATTTAAAAAAGTCCTCCAGGAAGAGGCTGCACAGATTAAAGCCAATGATGTGAATTCCACGTTCTACACCACAGAAATCAATGTCTATCCCGTTGACGGCCGCATCGATGTGCGTGGCGTGCTGAAAATGTGGATTGGTAACTCCAGGCCTTCCACGGAAATAAAAACCTACCGGCTTCGTCTGAAGTACACCGGAGGCTTTACCCGTATCGGTCGGTTCTATGAGGTGACGAATGAAAAA
TRN  10010101100011001
NAM  Q46998_ECOLI/1-187
ASQ  MEHGARLSTSR-------VMAIAFIFMSVLI-VLSLSVNVIQGVNNYRLQNEQRPAVTPMGFNVPFAVSQNSADASYLQQMALSFIALRLNVSPEIVDASHQALLQYIRPGAQNQMKVILAEEAKLIKKDNVNSAFFQTSVRVCLSMVVWKFRGIRKTWIGNSEPFTDIKHYILILKRENGVTWLDNFGETDDEK
DSQ  ATGGAACACGGTGCCCGTTTAAGTACCAGTCGT---------------------GTAATGGCCATCGCCTTTATATTTATGTCAGTGCTTATT---GTTCTCAGCCTCTCTGTTAACGTCATTCAGGGGGTGAATAACTACCGTCTTCAGAATGAGCAACGACCTGCCGTGACCCCAATGGGATTTAATGTGCCCTTTGCCGTGTCACAGAACAGTGCCGATGCCTCTTATTTGCAGCAGATGGCGCTGTCATTTATTGCCCTCCGTCTGAATGTCTCACCGGAAATCGTCGATGCTTCACATCAGGCGCTTCTGCAATATATCCGCCCGGGTGCACAGAACCAGATGAAAGTTATTCTGGCTGAAGAAGCGAAACTCATTAAAAAAGATAACGTGAATTCTGCTTTTTTCCAGACCAGTGTCCGTGTCTGCCTCAGTATGGTCGTGTGGAAATTCCGTGGAATTCGGAAAACATGGATTGGTAACTCCGAACCTTTTACTGATATCAAACATTACATCCTTATTCTGAAGCGGGAAAACGGGGTGACCTGGCTGGATAATTTCGGGGAAACAGACGATGAGAAA
TRN  10010101100011000
//