EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05198 - IF3_N)
FAM  PF05198
PID  IF3_N
DES  Translation initiation factor IF-3, N-terminal domain
IPR  IPR001288
ANO  39
ALN  76
AID  0.455958
APH  (((((((((((IF3_AQUAE/4-79:0.18800,((IF3_STRCO/2-77:0.23552,IF3_MYCLE/2-77:0.15234):0.13603,IF3_TREPA/10-85:0.50569):0.15344):0.12192,((IF3_RHOSH/13-88:0.19880,(IF3_CAUCR/7-82:0.32436,IF3_RHILO/12-87:0.30623):0.15973):0.14699,IF3_RICPR/16-91:0.38105):0.00769):0.05659,(((IF3_PSESM/14-89:0.44806,(IF3_SALTY/10-85:0.17449,IF3_PASMU/11-86:0.14440):0.09909):0.06737,(IF3_XYLFA/11-86:0.32192,IF3_MYXXA/11-86:0.33191):0.15183):0.04321,IF3_NEIMB/5-80:0.35446):0.01249):0.06470,((IF3_CHLMU/2-77:0.30660,IF3_THEMA/6-81:0.38538):0.13952,IF3_BORBU/17-91:0.37340):0.07283):0.06423,(((IF3_STRPY/6-81:0.36519,IF3_LACLA/12-86:0.30514):0.11613,(IF3_STAAW/6-81:0.24990,((IF3_BACHD/1-76:0.17261,IF3_LISMO/2-77:0.12320):0.05661,IF3_BACST/1-76:0.12992):0.04644):0.10494):0.07276,((IF3_DEIRA/5-80:0.32777,IF3_THET2/1-76:0.34702):0.10273,IF3_CLOAB/7-82:0.32801):0.06908):0.05003):0.12331,((IF3_HELPJ/3-78:0.18346,IF3_CAMJE/4-79:0.20315):0.28116,(IF3_MYCPU/13-87:0.38504,IF3_MYCFE/11-85:0.15836):0.30934):0.00000):0.18663,IF3C_CYACA/14-89:0.65781):0.04960,(IF3_SYNY3/9-84:0.14762,IF3C_PORPU/13-88:0.24723):0.18144):0.17689,IF3C_GALSU/13-88:0.29755):0.13884,((IF3_MYCGE/15-90:0.20233,IF3_MYCPN/32-107:0.08622):0.46764,IF3_UREPA/9-84:0.37982):0.14237):1.35631,Q9CZD5_MOUSE/70-144:0.11381,Q9H2K0_HUMAN/73-147:0.20626);
ATP  (((((((((((IF3_AQUAE/4-79,((IF3_STRCO/2-77,IF3_MYCLE/2-77),IF3_TREPA/10-85)),((IF3_RHOSH/13-88,(IF3_CAUCR/7-82,IF3_RHILO/12-87)),IF3_RICPR/16-91)),(((IF3_PSESM/14-89,(IF3_SALTY/10-85,IF3_PASMU/11-86)),(IF3_XYLFA/11-86,IF3_MYXXA/11-86)),IF3_NEIMB/5-80)),((IF3_CHLMU/2-77,IF3_THEMA/6-81),IF3_BORBU/17-91)),(((IF3_STRPY/6-81,IF3_LACLA/12-86),(IF3_STAAW/6-81,((IF3_BACHD/1-76,IF3_LISMO/2-77),IF3_BACST/1-76))),((IF3_DEIRA/5-80,IF3_THET2/1-76),IF3_CLOAB/7-82))),((IF3_HELPJ/3-78,IF3_CAMJE/4-79),(IF3_MYCPU/13-87,IF3_MYCFE/11-85))),IF3C_CYACA/14-89),(IF3_SYNY3/9-84,IF3C_PORPU/13-88)),IF3C_GALSU/13-88),((IF3_MYCGE/15-90,IF3_MYCPN/32-107),IF3_UREPA/9-84)),Q9CZD5_MOUSE/70-144,Q9H2K0_HUMAN/73-147);
ATL  16.5184
DNO  30
DLN  228
DID  0.502914
DPH  ((((((((((((IF3_CLOAB/7-82:0.27316,IF3_BORBU/17-91:0.35477):0.04977,IF3_RICPR/16-91:0.34895):0.04741,(IF3_SALTY/10-85:0.34676,((IF3_CHLMU/2-77:0.36269,IF3_TREPA/10-85:0.41961):0.08328,((IF3_AQUAE/4-79:0.32744,((IF3_DEIRA/5-80:0.28324,IF3_THET2/1-76:0.20288):0.11082,(((IF3_RHOSH/13-88:0.17468,IF3_RHILO/12-87:0.28536):0.07320,IF3_CAUCR/7-82:0.22694):0.05621,(IF3_MYXXA/11-86:0.27884,IF3_STRCO/2-77:0.21279):0.08000):0.04139):0.10325):0.05527,IF3_PSESM/14-89:0.31436):0.08163):0.07727):0.13210):0.03130,(IF3_HELPJ/3-78:0.29174,IF3_CAMJE/4-79:0.20496):0.14267):0.07842,((IF3_STAAW/6-81:0.15068,(IF3_LISMO/2-77:0.17570,IF3_BACST/1-76:0.21920):0.17008):0.10739,IF3_STRPY/6-81:0.30581):0.03163):0.06807,(IF3_MYCPN/32-107:0.44359,IF3_UREPA/9-84:0.25091):0.15878):0.07375,IF3_MYCFE/11-85:0.22556):0.14337,IF3C_GALSU/13-88:0.25447):0.06640,IF3C_CYACA/14-89:0.44429):0.10053,IF3C_PORPU/13-88:0.09774):0.22468,IF3_SYNY3/9-84:0.12123):0.74006,Q9CZD5_MOUSE/70-144:0.11948,Q9H2K0_HUMAN/73-147:0.22120);
DTP  ((((((((((((IF3_CLOAB/7-82,IF3_BORBU/17-91),IF3_RICPR/16-91),(IF3_SALTY/10-85,((IF3_CHLMU/2-77,IF3_TREPA/10-85),((IF3_AQUAE/4-79,((IF3_DEIRA/5-80,IF3_THET2/1-76),(((IF3_RHOSH/13-88,IF3_RHILO/12-87),IF3_CAUCR/7-82),(IF3_MYXXA/11-86,IF3_STRCO/2-77)))),IF3_PSESM/14-89)))),(IF3_HELPJ/3-78,IF3_CAMJE/4-79)),((IF3_STAAW/6-81,(IF3_LISMO/2-77,IF3_BACST/1-76)),IF3_STRPY/6-81)),(IF3_MYCPN/32-107,IF3_UREPA/9-84)),IF3_MYCFE/11-85),IF3C_GALSU/13-88),IF3C_CYACA/14-89),IF3C_PORPU/13-88),IF3_SYNY3/9-84),Q9CZD5_MOUSE/70-144,Q9H2K0_HUMAN/73-147);
DTL  10.9919
RID  0.449439
RPH  (((((((((IF3_PSESM/14-89:0.40493,IF3_SALTY/10-85:0.30044):0.08529,((((IF3_CHLMU/2-77:0.29302,IF3_TREPA/10-85:0.49500):0.11569,(IF3_MYXXA/11-86:0.32927,IF3_BORBU/17-91:0.38928):0.04642):0.12417,(IF3_AQUAE/4-79:0.22127,IF3_RICPR/16-91:0.39113):0.05547):0.02801,(IF3_STRCO/2-77:0.39561,(IF3_RHOSH/13-88:0.19122,(IF3_CAUCR/7-82:0.29599,IF3_RHILO/12-87:0.31956):0.18385):0.10465):0.07062):0.02078):0.08209,(((IF3_LISMO/2-77:0.14431,(IF3_STAAW/6-81:0.23373,IF3_STRPY/6-81:0.47356):0.01534):0.06051,IF3_BACST/1-76:0.10186):0.11682,((IF3_DEIRA/5-80:0.29448,IF3_CLOAB/7-82:0.35805):0.05964,IF3_THET2/1-76:0.38600):0.03843):0.07915):0.10181,IF3_MYCFE/11-85:0.44352):0.03276,(IF3_HELPJ/3-78:0.18360,IF3_CAMJE/4-79:0.19874):0.29519):0.20858,(IF3C_CYACA/14-89:0.69564,(IF3_SYNY3/9-84:0.12911,IF3C_PORPU/13-88:0.26576):0.17096):0.00641):0.20944,IF3C_GALSU/13-88:0.30128):0.15220,(IF3_MYCPN/32-107:0.51728,IF3_UREPA/9-84:0.37786):0.14742):1.34331,Q9CZD5_MOUSE/70-144:0.12518,Q9H2K0_HUMAN/73-147:0.19540);
RTP  (((((((((IF3_PSESM/14-89,IF3_SALTY/10-85),((((IF3_CHLMU/2-77,IF3_TREPA/10-85),(IF3_MYXXA/11-86,IF3_BORBU/17-91)),(IF3_AQUAE/4-79,IF3_RICPR/16-91)),(IF3_STRCO/2-77,(IF3_RHOSH/13-88,(IF3_CAUCR/7-82,IF3_RHILO/12-87))))),(((IF3_LISMO/2-77,(IF3_STAAW/6-81,IF3_STRPY/6-81)),IF3_BACST/1-76),((IF3_DEIRA/5-80,IF3_CLOAB/7-82),IF3_THET2/1-76))),IF3_MYCFE/11-85),(IF3_HELPJ/3-78,IF3_CAMJE/4-79)),(IF3C_CYACA/14-89,(IF3_SYNY3/9-84,IF3C_PORPU/13-88))),IF3C_GALSU/13-88),(IF3_MYCPN/32-107,IF3_UREPA/9-84)),Q9CZD5_MOUSE/70-144,Q9H2K0_HUMAN/73-147);
RTL  13.6448
LNK  IF3_AQUAE/4-79:O67653:AE000756
LNK  IF3_BACHD/1-76:Q9K867:
LNK  IF3_BACST/1-76:P03000:X16188
LNK  IF3_BORBU/17-91:O51208:AE001129
LNK  IF3_CAMJE/4-79:Q9PIS2:AL139074
LNK  IF3_CAUCR/7-82:Q9A9D9:AE005782
LNK  IF3C_CYACA/14-89:Q9TLX8:AF022186
LNK  IF3C_GALSU/13-88:Q9MS97:AF233069
LNK  IF3_CHLMU/2-77:Q9PL86:AE002289
LNK  IF3_CLOAB/7-82:Q97GK5:AE007736
LNK  IF3C_PORPU/13-88:P51231:U38804
LNK  IF3_DEIRA/5-80:Q9RSN7:AE002044
LNK  IF3_HELPJ/3-78:Q9ZMV2:AE001450
LNK  IF3_LACLA/12-86:Q9CEJ7:
LNK  IF3_LISMO/2-77:O53084:Y07640
LNK  IF3_MYCFE/11-85:Q05426:M95046
LNK  IF3_MYCGE/15-90:P47438:
LNK  IF3_MYCLE/2-77:Q9CC22:
LNK  IF3_MYCPN/32-107:P78024:AE000004
LNK  IF3_MYCPU/13-87:Q98QV2:
LNK  IF3_MYXXA/11-86:P48516:U04438
LNK  IF3_NEIMB/5-80:P65138:
LNK  IF3_PASMU/11-86:Q9CN42:
LNK  IF3_PSESM/14-89:P52834:U44118
LNK  IF3_RHILO/12-87:Q98CP5:AP003005
LNK  IF3_RHOSH/13-88:O33567:Y14733
LNK  IF3_RICPR/16-91:Q9ZD19:AJ235272
LNK  IF3_SALTY/10-85:P33321:L11254
LNK  IF3_STAAW/6-81:P65141:AP004827
LNK  IF3_STRCO/2-77:O88060:AL939109
LNK  IF3_STRPY/6-81:P65146:AE006531
LNK  IF3_SYNY3/9-84:P72874:D90901
LNK  IF3_THEMA/6-81:Q9X1S6:
LNK  IF3_THET2/1-76:Q9ACJ8:AJ409350
LNK  IF3_TREPA/10-85:O83822:AE001255
LNK  IF3_UREPA/9-84:Q9PQR4:AE002122
LNK  IF3_XYLFA/11-86:Q9PFE1:
LNK  Q9CZD5_MOUSE/70-144:Q9CZD5:AK012733
LNK  Q9H2K0_HUMAN/73-147:Q9H2K0:AF265440
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  IF3C_PORPU/13-88
ASQ  RDLPQINDRIKFPKVRVIDDEGEQLGIFAPEAAIQLATKQGLDLVLVSDKSDPPVCRILDYGKYKFTQEKRAREAK
DSQ  CGAGATTTACCTCAAATTAATGATCGTATTAAATTTCCAAAAGTACGAGTAATTGATGATGAAGGTGAGCAACTAGGTATTTTTGCGCCAGAAGCAGCTATTCAGTTAGCTACAAAACAAGGGCTGGATTTAGTTCTAGTTAGCGATAAATCTGATCCACCGGTATGTCGAATATTAGACTATGGTAAATATAAATTTACACAGGAAAAAAGAGCAAGAGAGGCGAAA
TRN  10010101100011010
NAM  IF3_SYNY3/9-84
ASQ  RDLPQINERIRFPEIRVIDSDGAQLGIITPNEAMEIADERGLDLVLVSETADPPVCRIMDYGKYKFEQEKKAREAK
DSQ  CGCGACTTACCTCAAATTAACGAAAGAATACGTTTCCCAGAAATACGAGTCATTGACAGTGACGGTGCCCAATTGGGGATCATTACCCCCAATGAAGCCATGGAAATCGCCGACGAGCGGGGGCTCGACCTTGTGTTAGTGAGTGAGACCGCCGATCCGCCGGTGTGCCGCATCATGGACTATGGCAAATATAAATTTGAGCAGGAGAAAAAAGCCCGGGAGGCCAAG
TRN  10010101110011010
NAM  IF3C_GALSU/13-88
ASQ  KNKFIINNKISFPIVRIIDENNYQLGIYKIEDALKLAEEKNLDLVLINDKTEPPVVRIIDYGKFKFAQEKKSREAK
DSQ  AAAAATAAATTTATTATTAATAATAAAATATCTTTTCCTATTGTACGAATAATTGACGAAAACAACTATCAACTAGGAATTTATAAGATAGAAGATGCTTTAAAACTGGCTGAAGAAAAAAATCTGGATTTGGTTTTAATTAATGATAAAACAGAACCACCAGTAGTAAGGATTATAGACTATGGAAAGTTTAAATTTGCTCAAGAAAAAAAGTCTCGAGAAGCAAAA
TRN  10010101100011010
NAM  IF3C_CYACA/14-89
ASQ  ESHILINENINFPCVRVVDVTGKQLGILDTRQAVEYAKNQGVDLVLVNEISDPPVCKLIDYGKHKFIVEKRVKEGR
DSQ  GAAAGTCATATATTGATTAATGAAAACATTAATTTCCCATGTGTTAGGGTTGTAGATGTGACTGGGAAACAGCTCGGGATTTTAGATACTAGACAAGCTGTCGAGTATGCAAAAAATCAAGGGGTAGATTTGGTTTTAGTTAATGAAATTTCCGATCCTCCAGTATGCAAACTTATTGATTATGGAAAACACAAGTTCATTGTTGAAAAAAGGGTCAAAGAAGGTAGA
TRN  10010101110011010
NAM  IF3_THEMA/6-81
ASQ  NTDLPRNEQIKAPKVRVVDENGKMIGVMPTRKALELAREKGLDLVLVAPNENPPVARIMDYGKYKYQLTKKQKENK
NAM  IF3_BORBU/17-91
ASQ  DKELKINYRIKAREVRVIFENGTQ-EVLSIEDAIKKAKEAGLDLVEVSPNVSPPVCKIIDYGKYKFHQEKRQKEQK
DSQ  GACAAGGAATTAAAAATTAATTACAGAATTAAGGCTCGCGAGGTAAGAGTTATTTTTGAAAATGGAACACAA---GAGGTTTTATCGATTGAAGATGCTATTAAAAAAGCAAAAGAAGCTGGACTTGATTTGGTTGAGGTTTCTCCTAATGTATCTCCTCCGGTTTGCAAGATTATTGATTATGGAAAATATAAATTCCATCAAGAAAAGCGTCAAAAAGAGCAAAAG
TRN  10010101110011010
NAM  IF3_TREPA/10-85
ASQ  NKSLRINGSIRVREVRLVDAVGQQCGVVPTPEALRMARDINLDLVEVAPQASPPVCKILDYGKYRFEMGKKLRDSK
DSQ  AACAAAAGCTTGCGGATTAATGGAAGTATTCGGGTACGAGAAGTGAGGTTGGTTGACGCTGTAGGGCAGCAGTGTGGGGTGGTGCCCACCCCTGAGGCGCTGAGAATGGCACGGGATATCAATCTTGATTTAGTAGAGGTCGCTCCGCAGGCGAGTCCGCCGGTGTGCAAGATCCTGGACTATGGGAAGTATCGCTTTGAGATGGGCAAAAAGTTGCGTGACTCGAAA
TRN  10010101100011010
NAM  IF3_MYCLE/2-77
ASQ  STETRVNERIRVPEVRLIGPGGEQVGIVRIEDALRVAADADLDLVEVAPNARPPVCKIMDYGKYKYEVAQKARESR
NAM  IF3_STRCO/2-77
ASQ  SAEPRINDRIRVPEVRLVGPSGEQVGIVPLAKALELAQEYDLDLVEVAANARPPVCKLMDYGKFKYESAMKAREAR
DSQ  AGCGCCGAGCCCCGCATCAACGACCGGATTCGCGTTCCCGAGGTGCGACTTGTCGGTCCCAGTGGTGAGCAGGTCGGGATTGTCCCGCTTGCCAAGGCCCTGGAGCTTGCGCAGGAGTACGACCTCGACCTCGTCGAGGTCGCGGCGAACGCCCGTCCGCCCGTGTGCAAGCTCATGGACTACGGGAAGTTCAAGTACGAGTCGGCCATGAAGGCCCGTGAGGCGCGC
TRN  11011111101111111
NAM  IF3_CHLMU/2-77
ASQ  ALNLKINRQIRAPRVRVIGSSGEQLGILSIKEALDLAREADLDLVEVASNSEPPVCKIMDYGKYRYDVTKKEKDSK
DSQ  GCTTTAAACCTAAAAATAAATAGGCAGATACGAGCTCCCAGGGTGCGTGTAATAGGTTCTTCTGGAGAGCAGCTAGGCATATTGAGTATAAAAGAGGCCCTAGATTTAGCCAGGGAAGCTGATTTAGACCTTGTTGAGGTTGCTTCAAACTCAGAGCCTCCCGTATGTAAGATCATGGACTACGGGAAGTATCGTTATGACGTAACTAAAAAAGAAAAGGATAGTAAG
TRN  10010101110011000
NAM  IF3_MYXXA/11-86
ASQ  SRDQRTNRRIRAREVRVVGSDGSQLGVMPLEAALDRARTEGLDLVEISPMASPPVCKIMDYGKFKYEEKKKASEAK
DSQ  AGCCGCGACCAGAGAACCAACCGTCGCATCCGTGCCCGTGAGGTCCGCGTCGTCGGGTCTGACGGTAGCCAGCTCGGGGTCATGCCTCTCGAGGCGGCCCTGGACCGTGCCCGGACCGAGGGGCTGGACCTCGTTGAAATCAGCCCCATGGCCAGTCCTCCGGTCTGCAAGATCATGGACTACGGCAAGTTCAAGTACGAGGAGAAGAAGAAGGCCTCGGAAGCGAAG
TRN  10010101100011011
NAM  IF3_CLOAB/7-82
ASQ  NKNFIVNEEIRQKEVRVIGDDGSQLGVIPTSEALKLAEEKELDLVAMSPNAVPPVCKIMDFGKFVYEQTKKEKENK
DSQ  AATAAAAATTTTATTGTAAATGAGGAAATAAGACAAAAAGAAGTTAGAGTAATAGGTGATGATGGTTCTCAGCTAGGAGTAATTCCTACAAGTGAAGCTTTAAAATTGGCTGAAGAGAAGGAACTTGATTTGGTTGCTATGTCACCTAATGCTGTTCCACCGGTTTGTAAGATAATGGATTTTGGTAAGTTTGTATATGAGCAAACTAAGAAGGAAAAAGAAAATAAG
TRN  10010101110011000
NAM  IF3_XYLFA/11-86
ASQ  NKQNRKNHEIRVPRVRVIGSDGEMVGVLSRDEALAMAEKEGLDLVEIQPQADPPVCKVMNFGKFKFEQQKKANEAK
NAM  IF3_PASMU/11-86
ASQ  NRPNRINDEIRVKEVRLIDQDGEQAGIVSIQQALEMAEQAELDLVEISPNAEPPVCRIMNYGKFLYEKGKAAKEQK
NAM  IF3_SALTY/10-85
ASQ  ARPNRINSEIRAQEVRLTGLEGEQLGIVSLREALEKAEEAGVDLVEISPNAEPPVCRIMDYGKFLYEKSKSSKEQK
DSQ  GCGCGTCCGAATCGTATTAATAGCGAAATTCGCGCGCAAGAAGTTCGCTTAACAGGTCTGGAAGGCGAGCAGCTTGGTATTGTGAGTCTGAGAGAAGCTCTGGAAAAAGCTGAAGAAGCCGGAGTAGACTTAGTCGAAATCAGCCCTAACGCCGAGCCGCCGGTTTGTCGTATAATGGATTACGGCAAATTCCTCTATGAAAAGAGTAAGTCTTCTAAGGAACAGAAG
TRN  10010101100011010
NAM  IF3_NEIMB/5-80
ASQ  EREARINGEITAKEVRLISESGEQLGVVSVREALAMAEGQDVDLVEISPTAKPPVCKLMDYGKYKYQQAKKRDEAK
NAM  IF3_PSESM/14-89
ASQ  APKAPINENISAREVRLIGADGEQIGIVSIDEALRIAEEAKLDLVEISADAVPPVCRVMDYGKSIFEKKKQVAAAK
DSQ  GCACCCAAGGCCCCGATCAATGAAAATATCTCGGCCCGCGAGGTTCGTTTAATTGGCGCTGACGGCGAGCAGATTGGCATCGTCTCGATTGATGAAGCGCTTCGTATTGCCGAAGAGGCGAAGCTGGATCTGGTAGAGATTTCTGCCGACGCAGTCCCTCCGGTCTGCCGTGTGATGGATTACGGCAAATCGATCTTCGAGAAGAAGAAGCAGGTTGCTGCAGCGAAG
TRN  11011101101011010
NAM  IF3_RHILO/12-87
ASQ  KDGPRSNRDIRVPRVQLIDAEGQNRGDVSINDALLLAEEAGLDLVEISPNAVPPVVKILDLGKLKYANQKKAAEAR
DSQ  AAGGATGGGCCGCGCTCCAACCGTGACATCCGGGTTCCCCGGGTCCAGCTTATCGACGCCGAAGGCCAGAACCGCGGCGATGTTTCCATCAACGACGCATTGCTGCTCGCCGAAGAGGCGGGGCTCGATCTCGTTGAGATATCGCCCAATGCGGTGCCGCCCGTCGTAAAGATCCTCGATCTCGGCAAGTTGAAATACGCCAACCAGAAGAAGGCGGCCGAGGCGCGC
TRN  10010101100011011
NAM  IF3_CAUCR/7-82
ASQ  KDGPRINDEIRVPRVLLIDQHGEKQGEMPTASAMEAAEEAGLDLVEIVPNANPPVCKILDYGKFKFQEQKKKNEAR
DSQ  AAAGACGGACCGCGTATCAACGATGAAATCCGTGTCCCTCGCGTCCTGCTGATCGACCAGCACGGCGAAAAGCAAGGCGAGATGCCGACCGCGTCCGCTATGGAAGCGGCAGAGGAAGCCGGCCTGGACCTGGTTGAAATCGTTCCGAACGCCAATCCTCCCGTCTGCAAGATCCTGGACTACGGCAAGTTCAAGTTCCAGGAGCAGAAGAAGAAGAACGAGGCGCGC
TRN  11011101101011011
NAM  IF3_AQUAE/4-79
ASQ  LKEYRVNRQIRAKECRLIDENGQQIGIVPIEEALKIAEEKGLDLVEIAPQAKPPVCKIMDYGKFKYELKKKEREAR
DSQ  CTGAAAGAGTACAGAGTGAACAGACAGATAAGGGCAAAGGAGTGCAGGCTTATAGACGAAAACGGACAGCAGATAGGAATAGTTCCTATTGAGGAAGCCCTAAAAATAGCCGAGGAGAAGGGATTGGATCTAGTTGAGATAGCACCTCAGGCAAAACCTCCCGTTTGCAAGATAATGGATTACGGAAAGTTCAAGTACGAACTCAAGAAAAAGGAAAGGGAGGCGAGA
TRN  10010101100011011
NAM  IF3_RICPR/16-91
ASQ  NNLPKANREIKAKEVRLVDENSEMYGVVNIREALDMAERAGLDLVEISPNAVPPVCKILDFGKFKYESKKRLHEAR
DSQ  AATAATTTGCCTAAGGCTAATAGAGAAATCAAAGCTAAAGAAGTACGTCTAGTAGACGAAAACAGCGAAATGTATGGTGTAGTAAATATTAGAGAAGCGTTAGATATGGCAGAAAGAGCCGGTCTTGATTTAGTTGAGATATCACCGAATGCTGTACCACCTGTCTGTAAAATTCTAGATTTTGGTAAGTTTAAGTATGAAAGTAAAAAGCGTTTACATGAGGCACGT
TRN  10010101110011000
NAM  IF3_RHOSH/13-88
ASQ  ETGPRVNERIRCPEVRLIGANGENIGVVTPSRAMMMAEEAGLDLVEISPNAEPPVCKIMDFGKFKYEQQKREAEAR
DSQ  GAAACGGGCCCCCGTGTCAACGAGCGAATCCGCTGCCCCGAGGTCCGACTGATCGGCGCCAATGGCGAGAACATCGGAGTCGTCACCCCCTCCCGTGCCATGATGATGGCCGAAGAGGCCGGTCTTGATCTTGTCGAGATCTCGCCGAACGCGGAACCGCCGGTCTGCAAGATCATGGACTTCGGCAAGTTCAAGTACGAGCAGCAGAAACGCGAGGCCGAGGCCCGC
TRN  11011101101011011
NAM  IF3_BACST/1-76
ASQ  SKDFIINEQIRAREVRLIDQNGDQLGIKSKQEALEIAARRNLDLVLVAPNAKPPVCRIMDYGKFRFEQQKKEKEAR
DSQ  AGCAAAGATTTCATTATCAACGAGCAAATTCGTGCCCGGGAAGTGCGCTTGATCGATCAAAACGGCGACCAACTTGGCATCAAGTCGAAGCAGGAAGCGCTCGAAATTGCGGCGAGACGCAACTTGGACCTCGTGCTTGTGGCGCCGAACGCCAAACCGCCTGTTTGCCGCATCATGGATTACGGGAAATTCCGCTTCGAGCAGCAGAAGAAAGAAAAAGAAGCGCGC
TRN  10010101110011011
NAM  IF3_LISMO/2-77
ASQ  SKDMLVNDGIRAREVRLIDQDGEQLGVKSKIDALQIAEKANLDLVLVAPTAKPPVARIMDYGKFRFEQQKKDKEAR
DSQ  AGCAAAGACATGTTGGTAAACGATGGGATTCGTGCACGTGAAGTAAGATTGATCGACCAAGACGGTGAACAATTAGGCGTGAAGAGTAAAATCGATGCGCTTCAAATTGCTGAAAAGGCTAATCTTGATCTAGTGCTTGTTGCTCCAACAGCGAAACCGCCAGTAGCTCGTATCATGGACTACGGTAAATTCCGTTTTGAACAACAGAAGAAAGATAAAGAAGCCCGT
TRN  10010101110011010
NAM  IF3_BACHD/1-76
ASQ  SKDMLVNEGIRAREVRLIGANGDQIGVKSKAEALDMARNVNLDLVCVAPNAKPPVCRIMDYGKYRYEQQKKDKEAR
NAM  IF3_STAAW/6-81
ASQ  KDQTQINDKIRAKELRLIGQDGEQIGVKSKREALEMAERVDLDLVVVAPNAKPPVARIMDYGKFKFEQQKKEKEMK
DSQ  AAAGATCAAACTCAAATCAATGACAAAATTCGTGCAAAAGAATTACGTTTAATCGGTCAAGATGGTGAACAAATTGGTGTTAAATCAAAGCGTGAAGCTTTAGAAATGGCTGAACGTGTAGATTTAGACTTAGTGGTCGTTGCACCGAATGCGAAACCACCAGTTGCAAGAATTATGGATTACGGTAAATTCAAATTCGAACAACAGAAAAAAGAAAAAGAAATGAAA
TRN  10110101110011000
NAM  IF3_THET2/1-76
ASQ  MKEYLTNERIRAKQVRVVGPDGKQLGIMDTREALRLAQEMDLDLVLVGPNADPPVARIMDYSKWRYEQQMAEKEAR
DSQ  ATAAAGGAGTACCTGACCAACGAACGCATACGCGCCAAACAGGTCCGCGTCGTCGGTCCCGACGGCAAGCAGCTCGGCATCATGGACACCCGGGAGGCCCTGCGCTTGGCCCAGGAGATGGACCTGGACCTGGTCCTGGTGGGCCCCAACGCCGATCCGCCCGTGGCCCGGATCATGGACTACTCCAAGTGGCGCTACGAGCAGCAGATGGCGGAGAAGGAGGCCCGG
TRN  11011101101011011
NAM  IF3_DEIRA/5-80
ASQ  AKDLKVNEQIRVRQVRLIGAEGEQIGIIDTREAMNMAREKSLDLVMVSPQAVPPVCRLLDYGRFRYEQQQNEKENR
DSQ  GCGAAAGATCTTAAGGTCAACGAGCAGATTCGCGTCCGGCAGGTCCGCCTGATCGGCGCGGAAGGGGAGCAGATCGGGATTATCGATACCCGCGAGGCCATGAACATGGCCCGTGAAAAGAGCTTGGACCTCGTGATGGTCAGCCCGCAGGCTGTGCCGCCCGTCTGCCGCCTCCTCGATTATGGCCGCTTCCGCTACGAGCAGCAGCAAAACGAGAAGGAAAACCGC
TRN  11011101101011011
NAM  IF3_LACLA/12-86
ASQ  NRKPMMNGAIRAREVRLIGAEGEQLGVTPTSEALMQAENLNMDLVLIS-NQEPPVAKIMDYTKFMFEQKKKQKEAK
NAM  IF3_STRPY/6-81
ASQ  KKDLFINDEIRVREVRLVGLEGEQLGIKPLSEAQSLADASNVDLVLIQPQAVPPVAKLMDYGKFKFEYQKKQKEQR
DSQ  AAAAAGGATCTATTCATTAATGATGAAATTCGCGTTCGCGAAGTTCGTCTCGTTGGTCTTGAAGGTGAACAATTAGGTATTAAACCATTGTCTGAAGCGCAATCATTGGCTGATGCTTCAAATGTTGATTTGGTTTTAATCCAGCCACAAGCTGTTCCTCCTGTTGCCAAACTTATGGACTATGGAAAGTTCAAATTTGAGTATCAAAAGAAACAGAAAGAACAACGT
TRN  11011101111011000
NAM  IF3_CAMJE/4-79
ASQ  EKEVLLNEEIRADEIRCVGDDGKVYGIISSDEALEIANRLGLDLVMIAADAKPPVCKIMDYGKFRYQQEKKQKEAK
DSQ  GAAAAAGAAGTATTGCTCAATGAAGAAATAAGAGCGGATGAAATCAGATGTGTTGGCGATGATGGCAAAGTTTATGGTATTATCAGTAGTGATGAAGCTTTAGAAATTGCAAATCGTTTAGGACTTGATCTTGTAATGATAGCTGCAGATGCTAAGCCACCTGTTTGCAAGATCATGGACTATGGTAAATTCCGTTATCAACAAGAGAAAAAACAAAAAGAAGCAAAG
TRN  10010101110011010
NAM  IF3_HELPJ/3-78
ASQ  RNEVLLNGDINFKEVRCVGDNGEVYGIISSKEALKIAQNLGLDLVLISASAKPPVCKVMDYNKFRYQNEKKIKEAK
DSQ  AGAAACGAAGTGTTGTTAAACGGAGACATTAATTTTAAAGAAGTGCGTTGCGTGGGCGATAATGGCGAAGTGTATGGGATCATTTCTTCCAAAGAAGCGCTAAAAATCGCTCAAAATTTAGGTTTGGATTTGGTTTTGATTTCAGCGAGCGCGAAACCTCCCGTGTGTAAGGTGATGGATTATAATAAATTCCGCTACCAAAATGAAAAGAAAATCAAGGAAGCCAAG
TRN  10010101110011000
NAM  IF3_MYCFE/11-85
ASQ  TAEHMINENIPFQKVFVIGANGEKVGVLSTREAIEMAKEQRLDLVLISVQPK-PIARILDYGKFKYERKKKQKAAK
DSQ  ACAGCAGAACACATGATTAATGAAAATATTCCATTTCAAAAAGTGTTTGTAATTGGTGCAAATGGTGAAAAAGTTGGTGTTTTATCAACACGTGAAGCCATTGAAATGGCCAAAGAACAAAGATTAGATTTAGTTCTAATTAGTGTTCAACCTAAA---CCAATTGCCCGTATTTTAGATTATGGGAAATTTAAATACGAAAGAAAAAAGAAACAAAAAGCAGCTAAA
TRN  10010101110011000
NAM  IF3_MYCPU/13-87
ASQ  KNKVLLNNDIPFSKVFLIGEDGEKIGIKTKEEALDIARGEKKDLVLISVQPK-PIARILDYGKFKYDRKKKEKEQK
NAM  IF3_UREPA/9-84
ASQ  KNQPLINDQIRFRTMVVIDDHGNNLGEMNRIDALNLAASKNLDLVVIAKKGNIPVTKILDYGKYKYEQKRRQKESR
DSQ  AAAAATCAACCTTTAATTAATGATCAAATTCGTTTTCGAACAATGGTTGTAATTGATGACCATGGTAATAATTTAGGTGAAATGAATCGTATTGATGCCCTTAATTTAGCCGCTTCAAAGAATTTAGATTTAGTTGTTATTGCTAAAAAAGGAAATATTCCTGTAACAAAAATTTTAGATTATGGTAAGTACAAATACGAACAAAAACGTCGTCAAAAAGAATCAAGA
TRN  10010101110011000
NAM  IF3_MYCPN/32-107
ASQ  EQKPLINDKIGFNEFILIDENGSNLGTVRRTDALKMAEEKQLDLVLIGSNPAKPIVKLLDFGRYTYDLKRKKRQSK
DSQ  GAACAAAAACCGTTAATTAACGATAAAATTGGCTTTAATGAGTTCATTTTAATTGACGAAAATGGCTCCAATTTGGGGACGGTTAGAAGGACCGATGCCCTCAAGATGGCTGAGGAAAAACAACTCGATTTAGTCTTAATTGGTTCAAACCCAGCCAAACCCATTGTTAAGCTCTTAGACTTTGGTCGTTACACTTATGATTTAAAACGCAAAAAACGCCAGTCCAAG
TRN  10010101110011000
NAM  IF3_MYCGE/15-90
ASQ  EQKPLVNEQIAFNQFTLIDENSTNLGIVKMENALKLAQEKQLDLVLIAPNPTKPIVKLLDFGRYTYDLKRKKRQAK
NAM  Q9H2K0_HUMAN/73-147
ASQ  TAFSNVGRKISQRVIHLFDEKGNDLGNMHRANVIRLMDERDLRLVQRNTSTEPAEYQLMT-GLQILQERQRLREME
DSQ  ACAGCTTTTAGTAACGTTGGAAGAAAAATTAGTCAGCGAGTTATTCACTTATTTGATGAGAAGGGCAATGATTTGGGAAACATGCACCGAGCAAATGTGATTAGACTTATGGATGAGCGAGACCTGCGACTGGTTCAAAGGAACACCAGCACAGAACCTGCAGAGTATCAGCTCATGACA---GGATTGCAGATCCTCCAGGAGCGGCAGAGGCTGAGGGAGATGGAG
TRN  10010101100011010
NAM  Q9CZD5_MOUSE/70-144
ASQ  DAFSNTGRKISERIIRVLDEKGMDLGMMHRADVIRLMNKQDLRLVQRNTSSEPPEYQLMT-GEQIHQERLKLREQE
DSQ  GATGCTTTCTCTAACACCGGCCGGAAGATTAGTGAGCGGATTATCCGCGTCCTGGATGAGAAGGGCATGGACCTGGGGATGATGCATCGAGCAGATGTGATCAGACTCATGAACAAGCAGGACCTGAGGCTGGTGCAGAGGAACACCAGCTCAGAGCCACCGGAGTACCAGCTTATGACC---GGAGAGCAGATCCACCAGGAGCGGCTAAAGCTCCGGGAACAGGAA
TRN  10010101100011001
//