EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05133 - Phage_prot_Gp6)
FAM  PF05133
PID  Phage_prot_Gp6
DES  Phage portal protein, SPP1 Gp6-like
IPR  IPR006428
ANO  5
ALN  486
AID  0.276917
APH  (((Q9K741_BACHD/14-451:0.46916,Q9AZ65_9CAUD/19-448:0.40718):0.46472,O34058_9CAUD/41-491:0.90875):0.85809,Q9G004_9CAUD/37-482:0.83316,SIZ_BPSPP/31-493:0.67544);
ATP  (((Q9K741_BACHD/14-451,Q9AZ65_9CAUD/19-448),O34058_9CAUD/41-491),Q9G004_9CAUD/37-482,SIZ_BPSPP/31-493);
ATL  4.6165
DNO  5
DLN  1458
DID  0.410165
DPH  ((Q9G004_9CAUD/37-482:0.51588,SIZ_BPSPP/31-493:0.50314):0.41967,(Q9AZ65_9CAUD/19-448:0.36508,Q9K741_BACHD/14-451:0.39833):0.18718,O34058_9CAUD/41-491:0.58860);
DTP  ((Q9G004_9CAUD/37-482,SIZ_BPSPP/31-493),(Q9AZ65_9CAUD/19-448,Q9K741_BACHD/14-451),O34058_9CAUD/41-491);
DTL  2.97788
RID  0.276917
RPH  (((Q9K741_BACHD/14-451:0.46916,Q9AZ65_9CAUD/19-448:0.40718):0.46472,O34058_9CAUD/41-491:0.90875):0.85809,Q9G004_9CAUD/37-482:0.83316,SIZ_BPSPP/31-493:0.67544);
RTP  (((Q9K741_BACHD/14-451,Q9AZ65_9CAUD/19-448),O34058_9CAUD/41-491),Q9G004_9CAUD/37-482,SIZ_BPSPP/31-493);
RTL  4.6165
LNK  O34058_9CAUD/41-491:O34058:U88974
LNK  Q9AZ65_9CAUD/19-448:Q9AZ65:AF304433
LNK  Q9G004_9CAUD/37-482:Q9G004:AP001553
LNK  Q9K741_BACHD/14-451:Q9K741:BA000004
LNK  SIZ_BPSPP/31-493:P54309:X56064
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  SIZ_BPSPP/31-493
ASQ  TTMIQKLIDEHNPEPLLKGVRYYMCENDIEKKR----RTYYDAAGQQLVDDTKTNNRTSHAWHKLFVDQKTQYLVGEPVTFTSDNKTLLEY----VNELAD-DDFDDILNETVKNMSNKGIEYWHPFVDEEGEFDYVIFPAEEMIVVYKDNTRRDILFALRYYSYKGIMGEETQKAELYTDTHVYYYEKIDGVYQMDYSYGEN--NPRPHMTKGGQAIGWGRVPIIPFKNNEEMVSDLKFYKDLIDNYDSITSSTMDSFSDFQQIVYVLKNY--DGENPKEFTANLRYHSVIKV---------SGDGGVDTLRAEIPVDSAAKELERIQDELYKSAQAVDNSPETIGGGATGPALENLYALLDLKANMAERKIRAGLRLFFWFFAEYLRNTGKG-DFNPDKELTMTFTRTRIQNDSEIVQSLVQGVTGGIMSKETAVARNPFVQDPEEELARIEEEMNQYAEMQGNLLDDEGGDDDLEEDDPNAGA
DSQ  ACAACCATGATCCAGAAGCTTATTGACGAACATAACCCGGAGCCGCTATTGAAGGGCGTCCGGTACTACATGTGCGAGAACGACATTGAGAAGAAGCGG------------CGCACATACTACGATGCCGCAGGACAGCAATTAGTGGACGACACAAAGACCAATAACCGTACTAGCCACGCATGGCACAAGCTGTTTGTGGATCAGAAAACACAGTACCTAGTGGGTGAGCCTGTTACATTCACATCAGACAATAAGACGTTATTAGAGTAC------------GTCAATGAGCTTGCAGAC---GACGACTTTGACGACATTTTGAACGAGACAGTCAAGAATATGTCAAACAAGGGTATTGAATACTGGCATCCGTTCGTTGATGAAGAAGGGGAATTTGATTATGTTATTTTCCCGGCTGAGGAAATGATTGTTGTATACAAAGACAACACCCGCCGCGACATCCTTTTTGCCCTCCGCTACTACTCATACAAGGGCATCATGGGTGAAGAGACACAGAAAGCAGAGCTGTACACAGACACACACGTTTACTACTACGAAAAAATTGACGGCGTTTATCAGATGGACTATTCATATGGCGAAAAT------AACCCCCGGCCGCATATGACAAAGGGTGGACAAGCCATAGGATGGGGAAGAGTACCGATCATCCCGTTCAAAAACAATGAGGAAATGGTGTCCGATCTTAAATTCTACAAGGATTTAATCGACAATTACGACAGCATCACATCCAGCACAATGGACTCATTCAGCGACTTCCAACAAATTGTGTACGTGCTCAAAAACTAT------GACGGGGAGAACCCGAAAGAATTCACGGCGAATTTAAGGTACCACAGTGTAATTAAGGTA---------------------------TCGGGCGATGGTGGTGTTGACACTTTACGGGCTGAAATACCTGTGGATAGTGCCGCAAAAGAGCTTGAAAGAATACAAGATGAGCTGTATAAATCCGCTCAGGCTGTGGATAATTCACCAGAAACAATCGGAGGAGGGGCTACAGGCCCAGCACTGGAAAACCTTTATGCGCTACTCGACTTGAAAGCGAACATGGCTGAACGGAAAATACGGGCTGGATTGCGCTTGTTCTTTTGGTTCTTCGCTGAATACCTACGCAACACAGGGAAGGGC---GATTTTAACCCGGATAAAGAGCTTACAATGACGTTCACACGCACTAGGATTCAGAATGACAGCGAGATTGTTCAGAGTCTTGTACAAGGCGTTACAGGTGGCATCATGAGTAAAGAGACGGCCGTCGCACGCAATCCATTTGTCCAAGACCCAGAGGAAGAATTGGCCCGCATAGAAGAGGAAATGAACCAATACGCTGAAATGCAGGGCAACCTACTCGACGATGAGGGCGGGGATGATGATTTAGAGGAGGATGATCCAAATGCCGGAGCC
TRN  10010101100011000
NAM  Q9G004_9CAUD/37-482
ASQ  EEMIVRYIKQHLEKLPEISIGQEYYEQRPDIV-----KEPKPVDATGAVDPLKPDDRMITNFHANLVDQKVSYIVGKPIAFKHTDDEVVKR----IDEVLG-NRFDDKLHSVLTGASNKGIEWLHPYLDEEGEFKLFRVPAEQGIPIWTDKEHEELEAFIRMYKLENETK-----VEYWDKVTVNYYVYENGSLIPDYSNN------LENSKTHFSTGSWGKIPFIPFKNNDLEISDIFMYKTLIDAYNRRLSDLSNTFKDSNELTYVLTNY--DDQELPEFKRLLRYYGAIKV---------SDNGGVDTIQVEVPVENSKKYLDELYQKIMLFGQAVDFSSDKFGSAPSGVALEFLYTNLNLKADKLARKAKVAIQELLWFVFEHFDIKGEHKD------VDISFNYNKVANTELQV--QTAQQSMGIVSHETVLENHPFVEDLQAELERIEQEQMEYNKQLPNLDDGGADGAQQQERSNNKES
DSQ  GAAGAAATGATTGTCAGATATATAAAACAACATTTGGAGAAGTTACCTGAAATCTCAATAGGTCAAGAATATTATGAGCAACGCCCTGATATTGTT---------------AAGGAACCCAAGCCGGTTGATGCTACAGGAGCAGTTGACCCATTGAAACCAGATGACAGAATGATTACCAACTTCCATGCTAACCTAGTAGATCAAAAAGTTTCTTATATTGTAGGGAAGCCTATCGCTTTTAAACATACAGATGATGAAGTAGTTAAACGT------------ATTGATGAAGTTTTAGGT---AATAGATTTGATGATAAGTTACACAGTGTACTAACAGGAGCTAGCAATAAAGGTATTGAATGGTTGCATCCTTACCTTGATGAAGAGGGAGAATTTAAGCTATTTAGAGTACCGGCGGAACAAGGTATTCCTATATGGACTGATAAAGAGCACGAAGAATTAGAGGCGTTTATCAGGATGTATAAATTGGAAAATGAAACTAAA---------------GTTGAATACTGGGATAAAGTAACTGTTAATTACTACGTTTATGAAAACGGCTCGCTTATTCCGGATTACTCTAACAAT------------------TTGGAGAATTCAAAAACACATTTTAGTACAGGGTCATGGGGTAAGATTCCATTTATTCCATTCAAAAATAACGATTTAGAAATATCAGATATATTTATGTATAAAACATTGATTGATGCTTATAACAGGCGATTATCCGATTTATCCAATACTTTTAAAGATTCAAACGAATTAACGTATGTATTAACGAACTAT------GATGACCAAGAGTTGCCAGAATTCAAACGGTTACTACGTTATTACGGGGCGATAAAAGTA---------------------------TCGGATAACGGGGGTGTCGACACAATACAGGTAGAAGTACCAGTTGAAAACAGTAAAAAGTATTTAGATGAGTTATATCAAAAAATAATGTTGTTTGGTCAAGCGGTTGACTTTAGTTCTGACAAATTCGGTTCGGCTCCAAGTGGGGTTGCGTTGGAGTTTTTATATACTAACTTAAACTTGAAAGCAGATAAGTTAGCGCGCAAAGCTAAAGTTGCTATACAGGAGTTGCTTTGGTTTGTGTTTGAGCACTTCGATATCAAAGGAGAACATAAAGAT------------------GTCGATATTAGTTTCAACTACAACAAAGTAGCGAACACAGAATTACAAGTA------CAAACAGCTCAACAATCTATGGGAATTGTAAGCCATGAAACAGTATTAGAAAATCACCCGTTTGTCGAAGATTTGCAAGCAGAACTCGAACGAATAGAACAAGAACAAATGGAGTACAACAAGCAACTGCCTAATTTAGATGACGGAGGTGCTGACGGTGCCCAACAACAAGAAAGATCTAACAATAAAGAATCA
TRN  10010101100011000
NAM  Q9K741_BACHD/14-451
ASQ  SERLKDFLDRHAARLS-R---------YERLMNMYMGKHP--ILYEKEKELGKPNNRLVVNFAKYIVDMLNGYFIGIPVKTIHENKEVAAK----MKEIAKRNSQNDNNAELSKMCSIYGHAYEFLYQDENAHTRVTYVDPREAFVIYDNTVAQEPLYGVRVLK----DDKERPYGTIYSRYDERD---FFTSDDGELVIEE---KGQEH--------FFGDVPLIEYVENNERQSAFESVETLINAYNKAISEKANDVDYFADAYLVILGAELDEETIK----QIRDNRVINL-----KSGDGQKIVLEFLDKPNADTTQENLIERLERLIFQISMVANISDEKF-GTSSGIALKYKLQPMENIALMKERKFNNGMIRRFKMMFNIPTNFGVDPD--EYLNIEYVFTRNIPNNILEEA--ETAEKLAGITSRQTQLSVLSVVDNVQNELDRIQKEKEGEEINSFNRDMNSPFFGSGELDDGQEEE
DSQ  AGCGAAAGATTAAAGGATTTCCTGGACCGTCATGCGGCGAGACTTTCT---CGC---------------------------TACGAGCGATTGATGAATATGTACATGGGTAAACATCCG------ATTTTGTATGAAAAAGAAAAAGAGCTAGGAAAACCGAACAACCGTTTAGTGGTCAATTTTGCAAAATACATTGTTGACATGCTGAATGGTTATTTTATTGGCATTCCGGTCAAAACCATTCATGAAAATAAAGAAGTGGCGGCCAAA------------ATGAAAGAAATTGCTAAACGAAACAGTCAAAACGATAATAACGCTGAGCTCTCGAAGATGTGTTCAATTTATGGTCATGCCTATGAATTTCTTTATCAGGATGAAAATGCTCATACTAGGGTGACCTATGTGGATCCGCGTGAGGCGTTTGTGATTTATGACAATACGGTTGCCCAGGAACCGTTATACGGCGTTCGTGTGCTAAAA------------GACGATAAAGAGCGGCCTTATGGGACGATTTATTCGCGTTATGATGAACGCGAT---------TTTTTTACGTCTGATGATGGCGAACTCGTGATTGAAGAA---------AAAGGCCAGGAGCAT------------------------TTTTTCGGCGATGTTCCTTTAATTGAATATGTCGAAAATAACGAGCGTCAGTCGGCCTTTGAAAGTGTGGAGACACTTATCAACGCCTACAATAAGGCGATATCAGAAAAAGCGAATGACGTTGATTATTTTGCCGACGCCTACTTGGTCATCCTGGGTGCTGAATTAGACGAGGAAACGATAAAG------------CAAATCCGGGATAATCGCGTGATCAATCTG---------------AAATCCGGAGACGGTCAAAAAATCGTACTGGAGTTCCTGGACAAACCGAACGCGGACACTACTCAGGAGAATTTGATTGAAAGGCTGGAGAGGCTTATTTTCCAGATTTCGATGGTGGCCAATATATCCGACGAAAAGTTC---GGCACTTCGTCCGGGATTGCATTGAAATACAAACTCCAGCCGATGGAAAACATCGCTCTAATGAAAGAGCGGAAATTCAACAATGGCATGATCCGGCGTTTTAAAATGATGTTCAATATTCCGACGAACTTTGGCGTGGATCCGGAC------GAATATCTGAACATCGAATATGTTTTTACGCGGAACATTCCAAACAACATTTTGGAAGAAGCG------GAAACTGCGGAAAAATTGGCCGGAATTACTTCAAGACAGACACAGCTATCCGTCCTGTCTGTTGTCGATAACGTTCAGAATGAATTGGACCGAATCCAAAAAGAGAAGGAAGGGGAAGAAATCAATTCCTTTAATCGCGACATGAATTCGCCTTTTTTCGGAAGCGGTGAGTTAGACGATGGCCAGGAAGAAGAA
TRN  10010101100011000
NAM  Q9AZ65_9CAUD/19-448
ASQ  VEVVTKFMEKHKLEVA-R---------YEYLKNMYLGIMA--IDDEPAKDSWKPDNRLAVNFTKYIVDTFTGYFNGIPVKKSHSDKEILTK----LQEFDNLNDMEDEESELAKMACIYGRAFEFLYQDEDTQTNVVYNSPENMFMVYDDTVKQEPLFAVRYGV----DEDKKLQGEVYTLL-ETI---KISGENDEISFGE----GTYN--------PYPDLPVVEFYFNEERMSIFESVISLVNAFNKAISEKANDVDYFSDQYLTFLGAAVEEEDLK----NIRSNRVINY----YADGEGKNVDVKFLEKPDSDSQTENLLDRLTKLIFQTTMVANISDESF-GSSSGVSLAYKLQAMSNLALSFQRKFQSSLNSRYKLFCELSTNVS-NKD--SWKDIEYTFTRNEPKDIKEQA--ETANILMGITSQETALSVISVIPDVQAEMEKIKKEEASTAIFDKDKQPSE------KGTDTVVSE
DSQ  GTTGAAGTGGTTACCAAGTTCATGGAAAAACATAAATTAGAAGTTGCT---CGG---------------------------TATGAGTACTTAAAAAATATGTATCTTGGAATTATGGCT------ATTGATGATGAACCGGCAAAAGACTCTTGGAAGCCTGACAATCGTTTAGCTGTTAATTTCACTAAATATATCGTTGATACTTTCACAGGTTACTTTAATGGGATTCCAGTTAAAAAGTCACATTCAGATAAAGAAATACTTACTAAA------------TTACAAGAATTTGATAATTTGAATGATATGGAAGATGAAGAATCAGAACTTGCAAAAATGGCATGTATTTATGGTCGAGCTTTTGAGTTTTTGTATCAAGACGAGGACACTCAAACGAATGTTGTTTATAATAGTCCAGAAAATATGTTTATGGTCTATGACGATACAGTCAAACAAGAGCCTTTATTTGCCGTGAGATATGGTGTT------------GACGAGGACAAAAAACTTCAAGGAGAAGTTTATACTCTACTT---GAAACTATT---------AAAATCAGCGGAGAAAATGACGAAATTAGCTTTGGAGAA------------GGGACTTACAAC------------------------CCATATCCAGATTTACCAGTTGTAGAGTTCTATTTCAACGAAGAACGAATGAGTATCTTTGAATCTGTTATTTCATTAGTCAACGCTTTTAACAAAGCAATTAGTGAAAAAGCAAATGACGTTGATTATTTTAGTGATCAGTACTTGACATTCTTAGGTGCTGCAGTTGAAGAAGAAGATTTGAAA------------AACATTCGTAGTAACCGTGTCATTAATTAC------------TATGCCGATGGTGAAGGCAAAAATGTGGATGTCAAATTCTTAGAAAAGCCTGATAGTGATTCTCAAACAGAAAATCTATTGGACCGACTGACTAAATTAATCTTCCAAACTACAATGGTTGCGAATATCTCTGATGAATCTTTC---GGGTCATCAAGTGGTGTCTCGTTAGCTTACAAGCTTCAAGCAATGAGTAACTTAGCTTTGTCATTTCAACGTAAGTTCCAATCTTCTTTGAATAGTCGATACAAACTATTTTGTGAGTTAAGTACGAATGTTTCG---AACAAAGAC------TCTTGGAAAGATATTGAGTACACCTTTACACGTAATGAGCCTAAAGATATTAAGGAACAAGCA------GAGACTGCTAATATCCTTATGGGAATCACAAGCCAAGAAACTGCTTTAAGTGTCATCTCTGTTATCCCAGATGTTCAAGCTGAAATGGAAAAAATCAAAAAAGAAGAAGCTTCTACAGCTATCTTTGACAAGGACAAGCAACCTAGTGAA------------------AAGGGAACAGATACAGTAGTTTCTGAA
TRN  10010101100011000
NAM  O34058_9CAUD/41-491
ASQ  WELLKNFINHHKLRQAPR---------IQELLDYARGENHDVLQFGRRKDREMADKRAVHNYGRMISKFKTGYLAGNPIRVEYDDNDNNSQNDDTIKRIGRINDIDSHNRTLIRDLSQTGRAYEVIYRNEYDETRIKRLNPLETFVIYDNSLEDNSIAAVRYYN-RGTLQNAKDVVEIYT---------NEHIYTLDASDDFNEISVTTH--------AFGTVPITEFLNNVDGIGDYETELYLIDLYDSAESDTANHMSDMADAILAIYGDLALPKGMQ--ASDMKRTRLMQLKPPKSADGKEGTVKAEYLTKSYDVSGAEAYKTRLNRDIHIFTNIPDMSDTNFSGNTSGEALKYKLFGLDQDRVDTQSQFTQGLKRRYRLAARIGSLVNEFKD-FDESLLKITFTPNLPKSLNEQV--SILTGLGGQVSQETALSLSGLVESPNEELDKINKEV---SEIDFKGYSNDFNEHVGKYTDEVKET
DSQ  TGGGAATTGTTGAAGAATTTCATCAATCACCATAAATTGAGACAAGCTCCACGG---------------------------ATTCAAGAGCTTTTGGATTATGCTAGAGGTGAAAACCACGACGTTCTTCAGTTTGGAAGACGTAAAGATAGGGAAATGGCTGATAAACGAGCTGTGCACAACTACGGTCGTATGATTAGCAAATTTAAAACAGGTTATTTAGCTGGAAATCCTATCCGTGTCGAATATGATGATAATGATAATAACTCACAAAATGACGATACTATTAAGCGAATAGGTCGAATTAACGACATAGATTCACACAATAGAACGCTTATCAGAGACTTATCTCAAACTGGTAGAGCTTATGAAGTTATCTATCGTAACGAGTATGACGAAACACGCATTAAGCGATTAAACCCGTTAGAAACATTTGTGATTTATGACAATTCATTAGAAGATAATTCAATCGCAGCTGTCAGATACTACAAT---CGAGGAACGCTCCAAAACGCAAAAGATGTAGTTGAAATTTACACA---------------------------AACGAACACATCTATACGCTTGATGCATCAGATGACTTTAATGAAATTTCAGTTACAACTCAC------------------------GCATTCGGTACAGTACCAATTACAGAGTTTCTAAACAATGTTGACGGTATCGGTGATTATGAGACTGAGCTTTACCTGATTGATTTATACGACAGTGCAGAGTCTGATACAGCAAACCACATGAGCGATATGGCAGACGCTATCCTTGCAATTTATGGGGACCTTGCCTTGCCTAAAGGTATGCAA------GCTAGTGACATGAAACGCACGCGCCTTATGCAGCTTAAACCTCCTAAATCAGCCGATGGCAAAGAGGGAACAGTCAAAGCTGAGTACCTCACGAAGTCTTACGACGTGTCTGGTGCAGAAGCATATAAGACACGTTTAAACAGAGATATTCATATATTTACTAACATCCCAGACATGTCAGATACAAATTTCAGCGGCAACACGTCTGGTGAGGCGTTGAAATACAAATTGTTTGGGTTAGACCAAGATAGAGTTGATACGCAATCTCAATTTACGCAAGGTTTGAAACGACGCTACCGTCTTGCCGCTCGTATTGGCTCATTAGTTAACGAGTTTAAAGAT---TTTGACGAAAGTCTATTGAAAATCACATTCACACCAAACCTTCCAAAATCGTTAAATGAGCAAGTA------TCTATTTTGACAGGATTGGGTGGTCAAGTATCGCAAGAAACTGCACTTAGTCTTTCAGGATTGGTAGAGAGTCCTAACGAAGAGTTGGACAAAATAAATAAAGAAGTG---------TCTGAAATCGATTTTAAGGGGTATTCTAATGACTTTAATGAACACGTAGGCAAATATACCGACGAGGTAAAAGAAACG
TRN  10010101100011000
//