EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04991 - LicD)
FAM  PF04991
PID  LicD
DES  LICD Protein Family
IPR  IPR007074
ANO  11
ALN  232
AID  0.262896
APH  (Q8E4B3_STRA3/24-249:0.48307,(((((Q8CWR1_STRR6/24-245:0.59284,Q8DPI0_STRR6/24-243:0.38816):0.19551,(Q8R630_FUSNN/25-235:1.16843,Q8G7N9_BIFLO/105-313:1.29746):0.38831):0.17745,(Q88YD0_LACPL/21-242:0.88162,Q8DPD7_STRR6/25-246:1.31551):0.14022):0.17955,(Q87Q28_VIBPA/24-242:0.94680,O07864_STRPN/20-249:1.27219):0.23472):0.18281,LICD_HAEIN/24-243:1.15338):0.57983,Q9CIZ2_LACLA/24-251:0.43592);
ATP  (Q8E4B3_STRA3/24-249,(((((Q8CWR1_STRR6/24-245,Q8DPI0_STRR6/24-243),(Q8R630_FUSNN/25-235,Q8G7N9_BIFLO/105-313)),(Q88YD0_LACPL/21-242,Q8DPD7_STRR6/25-246)),(Q87Q28_VIBPA/24-242,O07864_STRPN/20-249)),LICD_HAEIN/24-243),Q9CIZ2_LACLA/24-251);
ATL  12.0138
DNO  11
DLN  696
DID  0.403667
DPH  ((((((((Q8G7N9_BIFLO/105-313:0.77353,Q88YD0_LACPL/21-242:0.46401):0.19023,Q8DPD7_STRR6/25-246:0.57300):0.07190,Q87Q28_VIBPA/24-242:0.69627):0.11671,O07864_STRPN/20-249:0.67475):0.03178,LICD_HAEIN/24-243:0.66463):0.07285,(Q8DPI0_STRR6/24-243:0.35895,Q8CWR1_STRR6/24-245:0.41824):0.16575):0.09817,Q8R630_FUSNN/25-235:0.70129):0.18693,Q8E4B3_STRA3/24-249:0.41129,Q9CIZ2_LACLA/24-251:0.32344);
DTP  ((((((((Q8G7N9_BIFLO/105-313,Q88YD0_LACPL/21-242),Q8DPD7_STRR6/25-246),Q87Q28_VIBPA/24-242),O07864_STRPN/20-249),LICD_HAEIN/24-243),(Q8DPI0_STRR6/24-243,Q8CWR1_STRR6/24-245)),Q8R630_FUSNN/25-235),Q8E4B3_STRA3/24-249,Q9CIZ2_LACLA/24-251);
DTL  6.94284
RID  0.262896
RPH  (Q8E4B3_STRA3/24-249:0.48307,(((((Q8CWR1_STRR6/24-245:0.59284,Q8DPI0_STRR6/24-243:0.38816):0.19551,(Q8R630_FUSNN/25-235:1.16843,Q8G7N9_BIFLO/105-313:1.29746):0.38831):0.17745,(Q88YD0_LACPL/21-242:0.88162,Q8DPD7_STRR6/25-246:1.31551):0.14022):0.17955,(Q87Q28_VIBPA/24-242:0.94680,O07864_STRPN/20-249:1.27219):0.23472):0.18281,LICD_HAEIN/24-243:1.15338):0.57983,Q9CIZ2_LACLA/24-251:0.43592);
RTP  (Q8E4B3_STRA3/24-249,(((((Q8CWR1_STRR6/24-245,Q8DPI0_STRR6/24-243),(Q8R630_FUSNN/25-235,Q8G7N9_BIFLO/105-313)),(Q88YD0_LACPL/21-242,Q8DPD7_STRR6/25-246)),(Q87Q28_VIBPA/24-242,O07864_STRPN/20-249)),LICD_HAEIN/24-243),Q9CIZ2_LACLA/24-251);
RTL  12.0138
LNK  LICD_HAEIN/24-243:P14184:U32829
LNK  O07864_STRPN/20-249:O07864:AF004325
LNK  Q87Q28_VIBPA/24-242:Q87Q28:BA000031
LNK  Q88YD0_LACPL/21-242:Q88YD0:AL935254
LNK  Q8CWR1_STRR6/24-245:Q8CWR1:AE008487
LNK  Q8DPD7_STRR6/25-246:Q8DPD7:AE008494
LNK  Q8DPI0_STRR6/24-243:Q8DPI0:AE008487
LNK  Q8E4B3_STRA3/24-249:Q8E4B3:AL766851
LNK  Q8G7N9_BIFLO/105-313:Q8G7N9:AE014639
LNK  Q8R630_FUSNN/25-235:Q8R630:AE010630
LNK  Q9CIZ2_LACLA/24-251:Q9CIZ2:AE006259
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9CIZ2_LACLA/24-251
ASQ  CRENGIEYTLAGGSLIGAIRHGGYIPWDDDIDIELTRPHYDHLISVLMDQLP-NEKYALLHYKVRETYLPFAKLYDTRTSFTSKIDNLNRGT.GVFLDIFPMDILPDNEEE.RQVFKKEFLKKAIQLTASNPHGLDFASSSKKIYFWGKLVLWMPQHIRFYGKYRILAEKLDEFMQKYRNSDNQLISYLYTGYK-KAIFPKEIWEEYEDVKFEGLTARKLKNHEEYLTRQYG
DSQ  TGTCGAGAAAATGGTATTGAATATACGCTTGCAGGTGGTTCTCTAATTGGGGCAATTCGACATGGGGGATATATTCCTTGGGACGACGATATTGATATAGAGTTGACCCGGCCGCATTATGACCATTTAATTAGTGTTTTGATGGATCAACTGCCA---AATGAAAAGTATGCGCTCTTACATTATAAAGTAAGGGAAACTTATCTCCCTTTTGCTAAACTTTATGATACTCGTACAAGTTTTACAAGTAAAATTGACAACTTAAATCGTGGGACT...GGTGTCTTTTTAGATATCTTTCCAATGGATATCTTACCTGACAATGAAGAAGAA...AGACAAGTCTTTAAAAAAGAGTTTTTGAAAAAGGCGATTCAACTAACTGCTTCCAACCCTCATGGCTTAGATTTTGCAAGTTCAAGTAAAAAAATATATTTTTGGGGTAAACTTGTTTTATGGATGCCTCAACACATTCGTTTCTATGGGAAATATCGAATTTTGGCTGAAAAATTAGATGAATTCATGCAAAAATATCGTAATAGCGATAATCAGTTAATTAGCTATCTTTACACTGGCTATAAA---AAAGCTATCTTCCCTAAAGAAATTTGGGAAGAATACGAAGATGTTAAGTTTGAAGGGTTAACTGCTCGTAAACTCAAAAATCATGAGGAATATTTAACTCGTCAATATGGT
TRN  10010101100011000
NAM  Q8E4B3_STRA3/24-249
ASQ  ARDNKIEYSLGGGSLLGAMRHKGFIPWDDDIDLMLERSQYERLMKALADAN--NSDFKLLHHSVEKNLWPFAKLYHTKSMYLSKTDRIHPWT.GIFIDIFPLDRLPESAEE.RQRFFKKVHSAAANLMCTTYP--NFASGSRKLYANARLILGLPRFIAYHGQAKKRAEIVDQVMETYNNQEVPYMGYTDSRYRLKEYFPRKIFSEYEDVMFENIKTRKIKNEHAYLNQLYG
DSQ  GCGCGTGATAATAAAATTGAATATTCTTTAGGCGGAGGCAGCCTACTGGGAGCAATGAGACATAAAGGATTCATTCCATGGGATGACGATATTGATTTGATGCTAGAAAGAAGCCAGTATGAGCGTTTGATGAAAGCATTAGCTGATGCTAAT------AATAGCGATTTTAAATTGCTACATCATTCTGTTGAAAAAAATCTATGGCCATTTGCCAAGCTGTATCACACAAAGTCAATGTACTTAAGTAAAACAGATAGAATTCATCCTTGGACA...GGGATTTTTATTGATATCTTCCCACTTGACCGATTACCAGAGAGTGCAGAAGAA...CGTCAAAGATTCTTTAAAAAAGTTCACTCTGCTGCTGCAAATTTGATGTGTACGACTTACCCC------AATTTTGCTAGCGGTTCCCGAAAGCTTTATGCAAATGCAAGGCTAATTTTGGGGCTACCCCGATTCATCGCTTATCACGGCCAAGCTAAAAAACGTGCTGAAATTGTTGATCAAGTGATGGAAACATATAATAATCAAGAGGTTCCTTACATGGGTTATACCGATTCAAGATATCGCTTGAAAGAATATTTTCCAAGAAAAATTTTTTCTGAGTATGAAGATGTTATGTTTGAAAACATTAAAACCCGAAAAATTAAAAATGAGCATGCTTATCTGAATCAATTATATGGG
TRN  10010101100011000
NAM  Q88YD0_LACPL/21-242
ASQ  CEAENIDYFLIGGSLLGAIRHHGFIPWDDDIDIGMRRHDYQRFIAVANHHLDPNKFFLQTGASDPDYALSYMKLLDVNTYIEERNNVNNAFK.GVFVDIFPFDKIPDDE--.------ALRRSQMLHYKLADAAILLKLNYRFVKTPLRNLITKHTPQQLAEVNRYKLEREEYMRLYEQSDSRTYKNLASQYDYEKEIMTYQELTELTTVPFEDIQVKIPSAYDTILTRMYG
DSQ  TGTGAGGCTGAAAATATCGATTACTTTTTGATCGGTGGTTCTTTACTCGGTGCTATTCGTCATCACGGATTTATTCCGTGGGACGATGACATCGACATTGGAATGCGCCGTCATGACTACCAGCGCTTTATCGCCGTCGCCAACCACCATCTTGATCCAAACAAGTTTTTCCTACAAACCGGTGCCTCAGATCCGGACTATGCACTCAGTTATATGAAGCTATTAGACGTAAATACTTACATTGAAGAACGCAACAACGTCAATAATGCGTTTAAA...GGCGTGTTCGTTGACATCTTTCCGTTTGATAAGATTCCAGATGACGAA------...------------------GCCTTACGTCGTTCACAGATGTTACATTACAAATTAGCAGACGCTGCGATCCTGCTCAAATTGAATTACCGCTTTGTCAAAACACCACTGCGCAACTTGATTACGAAACACACACCTCAGCAATTAGCTGAAGTCAATCGCTATAAGCTGGAACGTGAGGAATACATGCGCCTGTACGAGCAGTCAGACTCCCGAACTTACAAAAATCTGGCGTCTCAATACGATTACGAAAAGGAAATTATGACCTATCAGGAATTGACCGAGCTAACGACCGTTCCATTCGAAGATATCCAAGTGAAGATTCCCAGTGCGTATGACACCATTTTGACCCGGATGTATGGT
TRN  11011101101011000
NAM  Q8CWR1_STRR6/24-245
ASQ  CKKHDIPYFLSYGTMLGAIRHKGMIPWDDDIDISLYREDYERLLKIIEEENH-PRYKVLSYDTSSWYFHNFASILDTSTVIEDHVKYKRHDT.SLFIDVFPIDRFTDLS--.--IVDKSYKYVALRQLAYIKKS-RAVHGDSKLKDFLRLCSWY--ALRFVNPRYFYKKIDQLVKNAVTNTPQYEGGVGIGKEGMKEIFPVDTFKELILTEFEGRMLPVPKKYDQFLTQMYG
DSQ  TGTAAGAAACATGATATTCCTTATTTTCTCAGTTATGGAACCATGCTTGGAGCCATCCGCCACAAAGGTATGATTCCTTGGGATGATGATATTGATATTTCCCTTTATCGTGAGGATTATGAGCGTTTACTGAAGATTATTGAAGAAGAAAATCAC---CCTCGCTACAAGGTTCTTTCCTACGATACATCTTCTTGGTACTTCCATAATTTCGCATCGATTTTGGACACTTCTACTGTTATAGAAGACCATGTTAAGTACAAGCGTCATGATACC...AGCCTTTTCATCGATGTCTTCCCAATTGATCGATTTACAGACTTGAGC------...------ATTGTCGACAAGAGCTATAAGTATGTGGCTCTTCGTCAACTAGCTTATATCAAAAAATCA---CGAGCAGTTCACGGTGATAGCAAACTAAAAGATTTTCTTAGATTATGTAGCTGGTAC------GCTCTCCGATTTGTCAATCCTCGCTACTTTTACAAGAAAATTGATCAACTAGTCAAAAATGCTGTAACCAACACTCCTCAATATGAAGGAGGAGTTGGGATCGGTAAGGAAGGGATGAAAGAAATCTTCCCAGTTGATACCTTTAAAGAACTGATTTTAACTGAGTTTGAGGGCCGTATGTTGCCTGTTCCCAAAAAATATGACCAATTTTTAACCCAGATGTATGGC
TRN  10010101100011000
NAM  Q8DPI0_STRR6/24-243
ASQ  CKKHNINYIINYGTLIGAVRHEGFIPWDDDIDLSMPREDYQRFINIFQKEKS--KYKLLSLETDKNYFNNFIKITDSTTKIIDTRNTKTYES.GIFIDIFPIDRFDDPK--.--VIDTCYKLESFKLLSFSKHK-NIVYKDSLLKDWIRTAFWL--LLRPVSPRYFANKIEKEIQKYSRENGQYMAFIPS-KFKEKEVFPSGTFDKTIDLPFENLSLPAPEKFDTILTQFYG
DSQ  TGTAAAAAGCACAATATCAACTATATTATTAACTACGGTACTCTGATTGGGGCGGTTCGACATGAGGGCTTTATCCCTTGGGACGACGATATTGATCTGTCCATGCCTAGAGAAGACTACCAACGATTTATTAACATTTTTCAAAAGGAAAAAAGC------AAGTATAAGCTCCTATCCTTAGAAACTGATAAGAACTACTTTAACAACTTTATCAAGATAACCGACAGTACGACTAAAATTATTGATACTCGAAATACAAAAACCTATGAGTCT...GGTATCTTTATCGATATTTTCCCTATAGATCGCTTTGATGATCCTAAG------...------GTCATTGATACTTGTTATAAACTGGAAAGCTTCAAACTGCTGTCTTTCAGTAAACATAAA---AATATTGTCTATAAGGATAGCCTTTTAAAAGATTGGATACGAACAGCCTTCTGGTTA------CTCCTTCGACCGGTTTCTCCTCGTTATTTTGCAAATAAAATCGAGAAAGAAATTCAAAAATATAGTCGTGAAAATGGGCAATATATGGCTTTTATCCCTTCA---AAATTTAAGGAAAAGGAAGTCTTCCCAAGTGGTACCTTTGATAAAACAATCGATTTACCCTTTGAGAATTTAAGCCTTCCTGCACCTGAAAAATTTGATACTATTTTGACACAATTTTATGGA
TRN  10010101100011000
NAM  LICD_HAEIN/24-243
ASQ  CERYKISYSLGGGTLIGAIRHKGFIPWDDDIDVYMHRDEYQRFVDVWFQETHEHYNMETAEDILAQYTGEMAKIFDCRTQITDAKGRKSP--.-MFMDIFIYDGVPNEP--.--KIIYPLMKKHRRIKLRFSS--CKKRWLRAKENTVQKAILN-KLSHFLFSKMQKNLAQFQIKYPIKQCDYIGLVLSDYGGWQKSYMPKEYFNHVIYKEFEGRQFQVMNGYHEHLTQYYG
DSQ  TGTGAACGATATAAAATTAGCTATTCTCTCGGTGGTGGAACATTAATCGGTGCTATACGCCACAAAGGCTTTATCCCTTGGGATGATGATATTGATGTTTATATGCACCGTGATGAATATCAAAGGTTCGTTGATGTTTGGTTTCAAGAAACTCACGAACACTACAATATGGAAACGGCGGAAGATATCCTTGCTCAATATACTGGTGAAATGGCAAAAATTTTCGATTGCCGCACTCAAATAACAGATGCTAAGGGAAGAAAAAGCCCA------...---ATGTTTATGGATATATTTATCTATGATGGCGTACCGAATGAACCA------...------AAGATCATCTATCCACTGATGAAAAAGCATCGAAGAATTAAACTTCGCTTTTCCTCT------TGCAAAAAAAGATGGTTAAGGGCAAAAGAAAACACCGTGCAAAAAGCTATACTTAAT---AAATTAAGCCACTTTCTATTTTCCAAAATGCAAAAAAATTTAGCACAATTCCAAATAAAATATCCGATAAAACAATGCGATTATATTGGTCTTGTATTATCTGACTACGGTGGTTGGCAAAAATCTTATATGCCGAAGGAATATTTTAACCATGTTATTTATAAAGAATTTGAAGGACGACAATTTCAAGTAATGAATGGATATCACGAACACTTAACACAATATTATGGA
TRN  10010101100011010
NAM  Q87Q28_VIBPA/24-242
ASQ  CERHDLEYSLAGGTLLGAIRHKGYIPWDDDIDIMMPREDYEYLLQNFAKEYP-DFTFFNLDTKHNPYPFLFSKLSLNDSVISNGRIKGVG--.-INIDIFPIDSLGKEK--.---GAAKLRFSLMKAINFFAR--IQRSRHDRANPIVNIAFRLFQKCLKLLPKKWFLSAIKGLCSTCSVNDDGYAVSIGSSYLAKEFTESSLYHDYTSCPFEDRQYKCIARYDDYLSMIYG
DSQ  TGTGAGCGTCACGATTTGGAGTACTCGCTGGCGGGTGGAACGCTGTTAGGGGCGATACGCCACAAAGGTTACATTCCTTGGGATGATGACATCGATATTATGATGCCAAGGGAAGATTACGAATACCTGTTGCAAAATTTTGCCAAAGAGTATCCT---GATTTCACGTTTTTCAATTTGGACACCAAGCACAATCCTTATCCGTTTTTGTTCAGCAAGCTATCTCTGAATGATTCTGTTATTTCGAACGGGCGAATTAAAGGCGTCGGG------...---ATCAATATTGATATATTTCCTATTGATAGCCTTGGTAAAGAGAAG------...---------GGGGCAGCAAAGTTACGCTTCTCATTAATGAAAGCGATCAACTTTTTCGCTCGT------ATTCAACGTTCGAGACATGATAGGGCAAACCCAATAGTAAATATCGCATTCCGGTTGTTTCAAAAGTGTTTAAAGCTTTTGCCTAAAAAATGGTTTCTATCAGCAATCAAAGGGTTGTGTTCAACATGCTCAGTTAATGATGATGGTTATGCCGTGAGCATTGGCAGCAGTTACCTTGCTAAAGAGTTTACGGAGTCATCGCTTTATCATGATTATACTTCGTGCCCATTTGAAGATCGTCAATATAAATGCATCGCTAGATACGATGATTACCTATCCATGATTTATGGT
TRN  10010101100011000
NAM  O07864_STRPN/20-249
ASQ  CEENDIDFFLRGGSVLGAVKYDGFIPWDDDMDIAVPREAYDKLPSVFKDRIIAGKYQVLTYQYCDTLHGYFPRLFLLEDERKRLGLPRNTNLgLHLIDIIPLDGAPNHSVLrKIYFGKVYWYRFLASLGTTYVG--DHVDMHSTKQKLIIGFFKKLGFAKLFPQNSVYRRLDNLYKKYDWKKQKYAGTINASLFAKEVMPVEIWGEGVEKPFEDTFFKVPTGYDRYLKRLYG
DSQ  TGTGAAGAGAATGATATAGATTTTTTCCTCCGCGGTGGTAGTGTACTTGGTGCAGTCAAATACGACGGCTTTATTCCATGGGATGATGATATGGATATCGCTGTCCCTCGTGAAGCATACGACAAACTTCCAAGTGTTTTCAAAGATAGAATTATCGCTGGGAAATATCAGGTTCTTACTTATCAATACTGTGATACGTTGCATGGCTACTTTCCTCGACTATTTCTTTTAGAAGATGAAAGAAAACGTTTGGGCTTGCCACGAAATACCAATCTGggaTTGCATTTGATTGATATCATTCCTTTAGATGGAGCACCAAATCATTCGGTTTTAagaAAGATTTACTTTGGTAAAGTATACTGGTATCGTTTTTTAGCAAGTTTAGGAACAACTTATGTTGGC------GACCATGTGGATATGCATTCCACTAAGCAAAAACTAATTATTGGTTTCTTTAAAAAACTAGGATTTGCAAAACTATTTCCTCAAAATTCTGTATACAGACGCTTGGATAATCTCTATAAAAAGTATGATTGGAAAAAGCAGAAGTATGCTGGGACTATCAATGCTTCTTTATTTGCCAAAGAAGTTATGCCAGTAGAGATTTGGGGAGAAGGAGTAGAGAAGCCTTTTGAGGATACCTTCTTTAAAGTTCCAACGGGGTATGATCGCTACCTGAAAAGACTTTACGGA
TRN  10010101100011010
NAM  Q8DPD7_STRR6/25-246
ASQ  CKEHDLLCYLCGGGAIGALRNKGFIPWDDDLDFFMPRKDYEKLAELWPRYAD-ERYFLSKSHKDFVDRNLFITIRDKKTTCIKPYQQDLDLPhGLALDVLPLDYYPKNPAE.---RKKQVRWALIYSLFCAQT---IPEKHGDLMKWGSRILLG--LTPKSLRYRIWKKAEKEMTKYDLADCDGITELCSGPGYMRNKYPITSFEDNLFLPFEGTEMPIPIGYDVYLRTAFG
DSQ  TGTAAAGAACATGATTTGCTCTGTTATCTCTGTGGCGGAGGCGCTATTGGTGCCCTTCGAAACAAGGGATTTATTCCTTGGGACGACGACCTAGACTTTTTTATGCCTCGTAAAGATTATGAGAAATTAGCAGAATTATGGCCTCGTTATGCAGAT---GAACGTTATTTCTTGTCAAAGAGTCACAAGGATTTTGTTGATCGTAATCTTTTTATTACCATTCGTGACAAGAAAACCACCTGTATCAAGCCTTATCAGCAGGATTTGGATTTGCCAcatGGTCTGGCCTTGGATGTTTTGCCTTTGGATTATTATCCGAAAAATCCAGCTGAG...---------CGGAAAAAACAGGTTCGTTGGGCCTTGATTTATTCACTCTTTTGTGCGCAAACT---------ATTCCAGAAAAGCATGGTGATCTCATGAAATGGGGAAGTCGCATTTTACTGGGT------TTGACTCCAAAATCTCTCCGTTATCGCATCTGGAAAAAAGCTGAGAAAGAAATGACTAAGTATGATTTGGCTGATTGTGATGGCATTACAGAATTATGCTCAGGTCCTGGCTACATGAGAAACAAGTACCCAATCACATCTTTTGAAGACAATCTTTTCTTGCCATTTGAAGGAACAGAGATGCCTATTCCAATCGGCTATGATGTCTATCTCAGAACTGCTTTTGGG
TRN  10010101100011000
NAM  Q8R630_FUSNN/25-235
ASQ  CNENKIRYWLDSGTLLGAVRHGGFIPWDDDIDIIIMQEDAKFLKENYKSEN-------FEIVNTDEEGINFYKVISKKEQVQVGDSIAELD-.--ID-IFLVTYYPDSLALkFWNSFFHLKKNRIDRFSFSLFFTNILINLKRKLEKTKLFNYKN---IEKKISYILDEAKKKNKAMPNIAYTPDCGFYLIIWREEEIFPLKK------MKFEGIEFSIPNNYDTYLKKMYY
DSQ  TGTAATGAAAATAAAATAAGATATTGGTTAGATTCAGGAACACTTTTAGGTGCAGTAAGACATGGTGGATTTATACCTTGGGATGATGATATTGATATTATAATTATGCAGGAAGATGCTAAATTTTTAAAAGAAAATTATAAAAGTGAAAAT---------------------TTTGAAATTGTAAACACTGATGAGGAAGGAATAAATTTTTATAAGGTTATTTCAAAAAAAGAGCAAGTTCAAGTGGGAGATAGTATTGCTGAATTAGAT---...------ATTGAT---ATTTTCTTAGTCACTTATTATCCAGATTCTTTGGCATTAaaaTTTTGGAATTCTTTTTTTCATTTAAAGAAAAATAGAATAGATAGATTTTCTTTTTCATTATTTTTTACTAATATATTAATTAATTTAAAGAGAAAATTAGAAAAGACAAAATTATTTAACTATAAGAAT---------ATTGAAAAGAAAATATCTTATATTCTTGATGAAGCTAAAAAGAAAAATAAGGCTATGCCAAATATTGCATATACCCCTGATTGTGGTTTTTATTTAATTATTTGGAGAGAAGAAGAGATATTCCCTCTAAAAAAA------------------ATGAAATTTGAAGGAATAGAATTTAGCATTCCTAATAATTATGATACTTATCTAAAAAAAATGTATTAT
TRN  10010101110011000
NAM  Q8G7N9_BIFLO/105-313
ASQ  CRDNNLPYWLDFGSLLGAVRHHGFIPWDDDTDLGMMREDIDRLQGIVQHDS----RYRLSLVYDAIAFCRQIRFMSSDTSNPCFVDIFIYD-.--YTDSTAIEVYDRRQ--.--HIRTELLDALRQSQFRAWHDLVYLSETSDGAAEIQQVFSR----YQREMEESGIVVSKENASGIMYGIDNVDNSSVRLYKLDDMFPTTCLT------FEDHEYQAPHTPMTVLTRNYG
DSQ  TGTCGAGACAACAACCTTCCATACTGGCTTGATTTCGGTTCATTACTTGGAGCTGTCCGCCATCACGGATTTATCCCGTGGGACGATGACACCGATCTTGGCATGATGAGAGAAGATATTGATCGTCTACAAGGTATTGTTCAACATGATTCT------------CGATATCGACTATCTCTGGTCTATGACGCAATCGCTTTTTGTCGGCAAATTCGTTTCATGTCTTCGGATACATCAAACCCATGTTTTGTGGATATTTTCATTTACGAT---...------TACACTGACTCCACCGCTATAGAAGTGTACGACCGACGTCAA------...------CATATTCGTACCGAATTACTTGATGCCCTCAGACAATCTCAATTCCGGGCATGGCATGACCTTGTGTATCTTAGCGAGACCTCCGATGGAGCAGCAGAAATTCAGCAGGTCTTTTCTCGC------------TATCAGAGGGAAATGGAAGAAAGCGGCATCGTGGTGTCGAAGGAGAATGCTTCCGGCATCATGTACGGCATCGATAATGTCGACAACTCATCTGTTCGTCTGTACAAACTTGATGACATGTTCCCCACAACATGTCTGACG------------------TTTGAAGACCACGAGTATCAAGCACCTCATACTCCAATGACCGTACTCACCCGTAACTACGGT
TRN  10010101100011000
//