EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04956 - TrbC)
FAM  PF04956
PID  TrbC
DES  Conjugal transfer protein TrbC
IPR  IPR007039
ANO  5
ALN  80
AID  0.375299
APH  ((P71178_ENTAE/33-112:0.11285,Q9PBT4_XYLFA/44-123:0.45241):0.10667,(Q98P50_RHILO/25-103:1.04221,O66170_9RHIZ/25-102:0.38011):0.27495,KLAC_ECOLI/74-153:1.11862);
ATP  ((P71178_ENTAE/33-112,Q9PBT4_XYLFA/44-123),(Q98P50_RHILO/25-103,O66170_9RHIZ/25-102),KLAC_ECOLI/74-153);
ATL  3.48782
DNO  5
DLN  240
DID  0.50879
DPH  (Q9PBT4_XYLFA/44-123:0.29572,((Q98P50_RHILO/25-103:0.52267,O66170_9RHIZ/25-102:0.26586):0.20934,P71178_ENTAE/33-112:0.14088):0.08506,KLAC_ECOLI/74-153:0.61115);
DTP  (Q9PBT4_XYLFA/44-123,((Q98P50_RHILO/25-103,O66170_9RHIZ/25-102),P71178_ENTAE/33-112),KLAC_ECOLI/74-153);
DTL  2.13068
RID  0.375299
RPH  ((P71178_ENTAE/33-112:0.11285,Q9PBT4_XYLFA/44-123:0.45241):0.10667,(Q98P50_RHILO/25-103:1.04221,O66170_9RHIZ/25-102:0.38011):0.27495,KLAC_ECOLI/74-153:1.11862);
RTP  ((P71178_ENTAE/33-112,Q9PBT4_XYLFA/44-123),(Q98P50_RHILO/25-103,O66170_9RHIZ/25-102),KLAC_ECOLI/74-153);
RTL  3.48782
LNK  KLAC_ECOLI/74-153:Q52329:M62426
LNK  O66170_9RHIZ/25-102:O66170:AB016260
LNK  P71178_ENTAE/33-112:P71178:U67194
LNK  Q98P50_RHILO/25-103:Q98P50:AP003017
LNK  Q9PBT4_XYLFA/44-123:Q9PBT4:AE004022
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9PBT4_XYLFA/44-123
ASQ  PAFASNTAGGGLPSDEWFTRIRESVTGPFAFTVAIVGIVAAGAGLIFGGDMNGFLRTLIFIVLVLSFLVAAQNSLSAITG
DSQ  CCGGCGTTCGCGTCAAACACGGCTGGCGGTGGTCTACCTTCAGATGAATGGTTCACTAGAATTCGCGAGTCTGTGACAGGTCCGTTTGCATTTACCGTAGCGATTGTTGGCATCGTTGCTGCTGGTGCAGGGCTTATTTTCGGTGGTGACATGAACGGCTTCTTGCGCACGCTCATCTTCATCGTCCTGGTGTTGTCCTTCTTGGTTGCCGCACAAAACAGCCTGAGTGCGATCACGGGG
TRN  10010101100011001
NAM  P71178_ENTAE/33-112
ASQ  HAFASEGTGGSLPYESWLTNLRNSVTGPVAFALSIIGIVVAGGILIFGGELNGFLRTLIFIVLVMGLLVGAQNMMSTFFG
DSQ  CACGCATTCGCCTCCGAGGGCACCGGCGGCTCTCTGCCGTATGAGAGCTGGCTGACCAACCTCCGCAACTCCGTCACCGGCCCGGTGGCCTTCGCGCTGTCGATCATCGGCATCGTGGTCGCCGGCGGCATCCTCATCTTCGGCGGCGAACTCAACGGCTTCTTGCGCACGTTGATCTTCATCGTCCTGGTCATGGGCCTGCTGGTCGGCGCGCAGAACATGATGAGCACGTTCTTCGGC
TRN  11011111101111111
NAM  O66170_9RHIZ/25-102
ASQ  PAFAS--SGGSLPWESPLQQIQQSITGPVAGFIALAAVAIAGGMLIFGGELNDFARRLCYVALVGGVLLGATQIIALFGA
DSQ  CCGGCCTTCGCCTCT------TCAGGCGGCAGTCTGCCGTGGGAATCCCCGCTTCAGCAAATCCAGCAATCGATCACCGGTCCGGTTGCCGGCTTCATCGCACTCGCCGCAGTCGCGATCGCCGGCGGCATGCTGATCTTCGGGGGCGAGTTGAATGATTTCGCAAGGCGGCTTTGCTACGTCGCCCTCGTTGGCGGCGTTCTGCTCGGCGCGACACAGATCATCGCCCTGTTCGGCGCA
TRN  10010101100011001
NAM  Q98P50_RHILO/25-103
ASQ  VAPVAHASGSSMPWEQPLEKILQSVEGPVSKIMAVIIIIVTGLTLAFGDSSGGF-RRLIQIVFGLSIAFAASSFFLSFFS
DSQ  GTCGCTCCGGTCGCCCATGCATCGGGCTCCTCGATGCCGTGGGAACAGCCGCTCGAAAAGATCCTGCAGTCGGTCGAGGGCCCGGTCTCCAAGATCATGGCCGTCATCATCATCATCGTCACCGGCCTGACGCTGGCCTTCGGCGACAGTTCGGGCGGCTTC---AGACGGCTCATCCAGATCGTTTTTGGTCTCTCGATCGCCTTTGCGGCGTCGAGTTTCTTTCTGTCGTTCTTCTCG
TRN  10010101100011011
NAM  KLAC_ECOLI/74-153
ASQ  PGSEGGGLGGGLPFTSAVGAFTDFMAGPAIFTLGILGIVVAGAVLVFGGEFSGFVRSVCMMVIAVSMIFVSSNLVKGILG
DSQ  CCGGGCAGTGAGGGCGGCGGCCTGGGTGGCGGCCTGCCCTTCACTTCGGCCGTCGGGGCATTCACGGACTTCATGGCGGGGCCGGCAATTTTTACCTTGGGCATTCTTGGCATAGTGGTCGCGGGTGCCGTGCTCGTGTTCGGGGGTGAATTCAGCGGGTTCGTGCGATCCGTCTGCATGATGGTGATAGCCGTCAGCATGATTTTCGTGTCGTCGAACTTGGTGAAGGGCATTCTCGGC
TRN  10010111100111011
//