EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04719 - TAFII28)
FAM  PF04719
PID  TAFII28
DES  hTAFII28-like protein conserved region
IPR  IPR006809
ANO  10
ALN  100
AID  0.401252
APH  ((((Q9C2R5_NEUCR/200-281:0.77726,(TAF11_YEAST/124-213:1.05656,Q9US54_SCHPO/93-181:0.19511):0.20080):0.05430,Q9AW46_GUITH/30-124:1.00017):0.22010,((Q20563_CAEEL/236-327:0.06192,Q21417_CAEEL/221-312:0.27371):0.31249,(Q99JX1_MOUSE/106-194:0.11548,TAF11_DROME/89-177:0.10169):0.14944):0.11780):0.48294,Q9M565_ARATH/105-194:0.20493,Q9LNS8_ARATH/128-217:0.14648);
ATP  ((((Q9C2R5_NEUCR/200-281,(TAF11_YEAST/124-213,Q9US54_SCHPO/93-181)),Q9AW46_GUITH/30-124),((Q20563_CAEEL/236-327,Q21417_CAEEL/221-312),(Q99JX1_MOUSE/106-194,TAF11_DROME/89-177))),Q9M565_ARATH/105-194,Q9LNS8_ARATH/128-217);
ATL  5.47118
DNO  10
DLN  300
DID  0.490052
DPH  (((((Q9C2R5_NEUCR/200-281:0.60307,(Q99JX1_MOUSE/106-194:0.18979,TAF11_DROME/89-177:0.17433):0.10390):0.11842,(Q20563_CAEEL/236-327:0.23645,Q21417_CAEEL/221-312:0.15813):0.21825):0.09767,(TAF11_YEAST/124-213:0.66340,Q9US54_SCHPO/93-181:0.31057):0.14227):0.11271,Q9AW46_GUITH/30-124:0.66147):0.23682,Q9M565_ARATH/105-194:0.13751,Q9LNS8_ARATH/128-217:0.14063);
DTP  (((((Q9C2R5_NEUCR/200-281,(Q99JX1_MOUSE/106-194,TAF11_DROME/89-177)),(Q20563_CAEEL/236-327,Q21417_CAEEL/221-312)),(TAF11_YEAST/124-213,Q9US54_SCHPO/93-181)),Q9AW46_GUITH/30-124),Q9M565_ARATH/105-194,Q9LNS8_ARATH/128-217);
DTL  4.30539
RID  0.401252
RPH  ((((Q9C2R5_NEUCR/200-281:0.77726,(TAF11_YEAST/124-213:1.05656,Q9US54_SCHPO/93-181:0.19511):0.20080):0.05430,Q9AW46_GUITH/30-124:1.00017):0.22010,((Q20563_CAEEL/236-327:0.06192,Q21417_CAEEL/221-312:0.27371):0.31249,(Q99JX1_MOUSE/106-194:0.11548,TAF11_DROME/89-177:0.10169):0.14944):0.11780):0.48294,Q9M565_ARATH/105-194:0.20493,Q9LNS8_ARATH/128-217:0.14648);
RTP  ((((Q9C2R5_NEUCR/200-281,(TAF11_YEAST/124-213,Q9US54_SCHPO/93-181)),Q9AW46_GUITH/30-124),((Q20563_CAEEL/236-327,Q21417_CAEEL/221-312),(Q99JX1_MOUSE/106-194,TAF11_DROME/89-177))),Q9M565_ARATH/105-194,Q9LNS8_ARATH/128-217);
RTL  5.47118
LNK  Q20563_CAEEL/236-327:Q20563:U58732
LNK  Q21417_CAEEL/221-312:Q21417:Z75545
LNK  Q99JX1_MOUSE/106-194:Q99JX1:BC005603
LNK  Q9AW46_GUITH/30-124:Q9AW46:AJ010592
LNK  Q9C2R5_NEUCR/200-281:Q9C2R5:AL513410
LNK  Q9LNS8_ARATH/128-217:Q9LNS8:AC022472
LNK  Q9M565_ARATH/105-194:Q9M565:AF238326
LNK  Q9US54_SCHPO/93-181:Q9US54:AL136078
LNK  TAF11_DROME/89-177:P49906:S67660
LNK  TAF11_YEAST/124-213:Q04226:U85960
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  TAF11_DROME/89-177
ASQ  MQVLVSNFTEEQLDRYEMYRRSAFPKAAVKRLMQT---ITG-CSVSQNVVIAMSGIAKVFVGEVVEEALDVME.-AQGESG-----ALQPKFIREAVRRL
DSQ  ATGCAGGTTCTCGTTTCCAACTTTACTGAAGAACAGCTGGATCGCTACGAAATGTATCGTCGCTCAGCCTTTCCCAAGGCCGCCGTCAAGCGTCTAATGCAAACT---------ATCACCGGC---TGTTCCGTGTCCCAAAATGTTGTGATAGCCATGTCCGGCATTGCGAAGGTCTTCGTCGGCGAGGTTGTGGAGGAAGCCCTCGACGTGATGGAG...---GCCCAAGGTGAATCCGGT---------------GCCCTGCAGCCCAAATTCATACGAGAGGCAGTGCGACGACTG
TRN  10010101100011001
NAM  Q99JX1_MOUSE/106-194
ASQ  MQILVSSFSEEQLNRYEMYRRSAFPKAAIKRLIQS---ITG-TSVSQNVVIAMSGISKVFVGEVVEEALDVCE.-KWGETP-----PLQPKHMREAVRRL
DSQ  ATGCAAATCCTGGTCTCTTCTTTTTCTGAGGAGCAGCTGAACCGTTATGAAATGTATCGCAGGTCAGCTTTCCCCAAGGCGGCCATTAAAAGGCTGATCCAGTCC---------ATCACTGGC---ACCTCTGTGTCTCAGAATGTTGTGATTGCCATGTCTGGCATTTCTAAGGTTTTTGTCGGGGAGGTGGTAGAAGAAGCCCTGGACGTGTGTGAG...---AAATGGGGAGAAACGCCA---------------CCCCTGCAGCCCAAGCACATGAGGGAGGCCGTCCGGAGGTTG
TRN  10010101100011001
NAM  Q21417_CAEEL/221-312
ASQ  NQVLVANFSQEQIERYEVYRKSSFKKSTIKRLINE---FTGGIDLGKKVDIAVAGLAKVLVGEIVEEALDIRDlDEKEAKE-----PLQPHHIRQAYLRL
DSQ  AATCAAGTTCTCGTTGCCAACTTCTCACAAGAACAAATTGAACGATACGAGGTTTATAGAAAATCATCGTTTAAAAAGTCCACAATCAAACGTCTTATCAATGAA---------TTCACTGGAGGAATTGACCTTGGAAAAAAGGTAGATATTGCAGTAGCTGGATTGGCAAAAGTGTTGGTTGGCGAAATTGTTGAAGAAGCTCTTGATATCAGAGATttgGATGAAAAAGAAGCAAAAGAA---------------CCACTCCAGCCACATCACATTCGTCAGGCATATCTTCGTCTT
TRN  10010101110011001
NAM  Q20563_CAEEL/236-327
ASQ  TQVLLSNFSQEQLERYESYRRSSFQKSTIRRLISQ---YTGGVNVGQSVVIAIAGLAKVFVGEVVEEALDIRDiNEEEASN-----PLQPHHIRQAFLRL
DSQ  ACACAAGTTTTGCTTTCCAACTTTTCACAAGAGCAACTGGAAAGATATGAGTCATACAGACGCTCTTCATTCCAAAAGTCGACTATTCGCCGTTTGATCAGTCAG---------TACACTGGAGGAGTGAACGTTGGACAGAGTGTGGTCATCGCTATCGCAGGATTGGCTAAGGTGTTCGTCGGTGAAGTTGTCGAAGAAGCATTGGATATTCGTGACataAATGAGGAAGAAGCTAGCAAT---------------CCACTACAGCCGCATCATATTCGTCAAGCGTTCCTCCGGCTC
TRN  10010101100011001
NAM  Q9LNS8_ARATH/128-217
ASQ  MQKILSQFTEEQMSRYESFRRSGFKKSDMEKLVQR---ITGGPKMDDTMNIVVRGIAKMFVGDLVETARVVMR.-ERKESG-----PIRPCHIRESYRRL
DSQ  ATGCAGAAGATTTTATCACAATTTACAGAGGAACAAATGAGCAGATATGAATCTTTCAGAAGATCTGGTTTTAAGAAATCAGACATGGAGAAGTTGGTACAGAGA---------ATCACAGGGGGTCCGAAGATGGACGACACTATGAACATCGTTGTGCGTGGTATCGCAAAGATGTTTGTTGGCGACCTTGTGGAAACAGCTCGAGTTGTTATGAGG...---GAAAGGAAGGAATCAGGA---------------CCTATTAGACCTTGCCATATCAGAGAGTCATATCGAAGACTA
TRN  10010101110011000
NAM  Q9M565_ARATH/105-194
ASQ  MQTILSQFTEDQMSRYESFRRSALQRPQMKKLLIG---VTGSQKIGMPMIIVACGIAKMFVGELVETARVVMA.-ERKESG-----PIRPCHIRESYRRL
DSQ  ATGCAAACCATATTATCGCAATTCACTGAGGATCAGATGAGTAGATATGAATCTTTTAGGAGATCTGCACTTCAAAGACCACAGATGAAGAAGTTATTGATAGGT---------GTCACTGGTAGTCAGAAGATTGGTATGCCAATGATTATTGTTGCGTGTGGTATTGCAAAGATGTTCGTTGGTGAACTCGTTGAAACAGCTCGAGTTGTTATGGCG...---GAAAGGAAAGAATCAGGA---------------CCTATCAGACCTTGTCATATCAGGGAGTCTTATCGGAGACTA
TRN  10010101110011000
NAM  Q9US54_SCHPO/93-181
ASQ  TKYLLESFDEEQMQRYEVFRRANLNKTNVKKLANQ---ILN-QSVTPNVAIVISGFSKVFVGEIVELARKIQD.-QWGDTG-----PLSPDHLREAYRLS
DSQ  ACAAAATATCTTCTAGAGAGTTTTGATGAAGAGCAAATGCAAAGATACGAAGTGTTTCGTCGTGCTAACTTAAATAAAACCAATGTTAAAAAATTGGCTAACCAA---------ATTTTAAAC---CAAAGTGTAACCCCCAATGTTGCTATTGTGATCTCAGGATTTTCAAAGGTGTTTGTTGGAGAAATCGTTGAATTAGCTCGAAAGATTCAAGAT...---CAATGGGGGGATACTGGT---------------CCACTGAGTCCTGATCATTTACGAGAGGCGTATAGATTATCA
TRN  10010101100011000
NAM  Q9C2R5_NEUCR/200-281
ASQ  RGMLINAFSPDQFDRFENWRAANLSKAGVRRLINA---TIS-QSVTENVVIGMRAVAKVFIGDIIEGARRVQA.-EWIEKTG------------EKQTDL
DSQ  AGGGGAATGCTGATTAATGCCTTTTCCCCGGATCAGTTTGATCGTTTTGAGAACTGGAGGGCGGCGAACTTGAGTAAAGCTGGTGTTAGGAGGTTGATCAACGCA---------ACCATCTCC---CAGTCCGTTACCGAAAACGTGGTTATTGGCATGCGCGCGGTAGCCAAGGTCTTCATCGGCGACATCATCGAGGGCGCACGTCGTGTGCAAGCG...---GAGTGGATCGAGAAGACGGGC------------------------------------GAGAAGCAGACCGATTTG
TRN  10010101100011011
NAM  Q9AW46_GUITH/30-124
ASQ  DYEKINKLTRFQLMRYGIFRRSDLKKEKIKKIISQSNVVLKNITSMDPLIIAIKGLAKIYIGEKIEKAKQVM-.FEIEDTSRWMSSPIQNNHL---IKSL
DSQ  GACTACGAAAAAATAAATAAGTTAACCCGATTTCAACTAATGCGATATGGAATTTTTAGAAGATCTGATTTGAAAAAGGAGAAGATAAAAAAGATAATCAGTCAAAGTAATGTTGTTTTAAAAAACATTACCTCTATGGATCCCTTAATTATTGCAATAAAAGGTCTTGCTAAAATTTACATAGGTGAAAAGATTGAAAAGGCAAAGCAAGTTATG---...TTTGAAATAGAGGATACATCTAGATGGATGAGCTCTCCGATACAAAATAACCATCTT---------ATTAAATCATTA
TRN  10010101110011000
NAM  TAF11_YEAST/124-213
ASQ  FKLLVTNLDKDQTNRFEVFHRTSLNKTQVKKLAST---VAN-QTISENIRVFLQAVGKIYAGEIIELAMIVKNkWLTSQMC------IEFDKRTKIGYKL
DSQ  TTCAAGCTCTTGGTAACCAACTTGGATAAAGATCAAACTAATCGGTTTGAAGTTTTCCATAGAACATCCCTAAACAAAACCCAGGTCAAAAAACTGGCTAGCACA---------GTAGCTAAT---CAAACTATAAGTGAAAATATTCGTGTTTTTCTGCAAGCGGTGGGAAAAATATACGCTGGTGAGATAATCGAATTGGCCATGATTGTGAAGAATaagTGGTTGACAAGTCAAATGTGC------------------ATAGAGTTTGATAAGAGGACCAAAATAGGCTATAAATTG
TRN  10010101100011011
//