EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04703 - FaeA)
FAM  PF04703
PID  FaeA
DES  FaeA-like protein
IPR  IPR006793
ANO  5
ALN  71
AID  0.460944
APH  (((Q9ADX3_ECOLI/1-62:0.17237,DAAF_ECOLI/11-72:0.23654):0.11889,Q47193_ECOLI/5-65:0.59395):0.26639,Q47204_ECOLI/1-61:0.26727,Q9EUH2_SALEN/1-70:0.98219);
ATP  (((Q9ADX3_ECOLI/1-62,DAAF_ECOLI/11-72),Q47193_ECOLI/5-65),Q47204_ECOLI/1-61,Q9EUH2_SALEN/1-70);
ATL  2.6376
DNO  5
DLN  213
DID  0.514644
DPH  (((Q9ADX3_ECOLI/1-62:0.25027,Q47193_ECOLI/5-65:0.50805):0.04296,DAAF_ECOLI/11-72:0.17869):0.27009,Q47204_ECOLI/1-61:0.15146,Q9EUH2_SALEN/1-70:0.67321);
DTP  (((Q9ADX3_ECOLI/1-62,Q47193_ECOLI/5-65),DAAF_ECOLI/11-72),Q47204_ECOLI/1-61,Q9EUH2_SALEN/1-70);
DTL  2.07473
RID  0.460944
RPH  (((Q9ADX3_ECOLI/1-62:0.17237,DAAF_ECOLI/11-72:0.23654):0.11889,Q47193_ECOLI/5-65:0.59395):0.26639,Q47204_ECOLI/1-61:0.26727,Q9EUH2_SALEN/1-70:0.98219);
RTP  (((Q9ADX3_ECOLI/1-62,DAAF_ECOLI/11-72),Q47193_ECOLI/5-65),Q47204_ECOLI/1-61,Q9EUH2_SALEN/1-70);
RTL  2.6376
LNK  DAAF_ECOLI/11-72:Q47132:M98766
LNK  Q47193_ECOLI/5-65:Q47193:L07420
LNK  Q47204_ECOLI/1-61:Q47204:X77671
LNK  Q9ADX3_ECOLI/1-62:Q9ADX3:AF072900
LNK  Q9EUH2_SALEN/1-70:Q9EUH2:AB041905
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9EUH2_SALEN/1-70
ASQ  MSESIITHIISIIRERQNAHDGAPVKTRDIADAAGLSIYQVRSYLEQLRAVGMLEKVNAGKGVPGLWRLL-
DSQ  ATGAGTGAATCCATCATTACACATATCATCTCCATCATCCGGGAGCGGCAGAACGCGCACGACGGCGCGCCTGTTAAAACCCGCGATATTGCCGATGCTGCCGGACTCAGTATCTACCAGGTCCGCTCGTATCTTGAGCAGCTCCGCGCTGTCGGGATGCTTGAGAAAGTGAATGCCGGAAAGGGAGTACCCGGATTATGGCGTCTGCTC---
TRN  11011101101011010
NAM  Q9ADX3_ECOLI/1-62
ASQ  MKDNILTFLTEL---------KTPCRTTEIAIHFGLSAYQARYYLMNLEKEGKIKRSPVRRGASTLWEMNS
DSQ  ATGAAAGACAATATACTGACGTTCCTAACGGAGCTG---------------------------AAAACTCCGTGCCGGACAACAGAAATTGCCATACATTTTGGGCTGAGTGCCTATCAGGCCAGATATTACCTGATGAATCTCGAAAAGGAGGGAAAGATAAAACGCTCGCCGGTAAGGAGAGGTGCCAGTACCTTATGGGAAATGAATTCG
TRN  10010101100011010
NAM  DAAF_ECOLI/11-72
ASQ  RKNDILSYFGEI---------NAPCRTSEVAEHLGVSAYQARHYLQCLEKEGKIKRSPVRRGASTLWEISS
DSQ  CGTAAGAATGACATTCTTTCTTATTTCGGAGAAATC---------------------------AATGCCCCCTGCAGAACCTCAGAAGTTGCTGAACATTTAGGGGTAAGTGCTTATCAGGCCAGACATTACCTGCAGTGTCTGGAGAAGGAAGGGAAAATTAAACGCTCACCGGTACGACGGGGAGCCAGTACGCTGTGGGAAATCAGCAGT
TRN  10010101100011000
NAM  Q47204_ECOLI/1-61
ASQ  MKEHILEYINS----------RGSCTTREIADATGISAYQARYYLMTLDREKKIRRTPLRQGARTLWGVLR
DSQ  ATGAAAGAACACATCCTTGAATACATAAATTCC------------------------------AGAGGTTCCTGTACAACACGGGAAATTGCTGACGCCACAGGTATATCTGCTTATCAGGCCAGGTATTACCTTATGACTCTTGACAGGGAAAAGAAAATCAGACGTACTCCTCTTCGTCAGGGAGCCCGTACTTTATGGGGAGTACTCAGA
TRN  10010101110011010
NAM  Q47193_ECOLI/5-65
ASQ  MKNEILEFLNR----------HNGGKTAEIAEALAVTDYQARYYLLLLEKAGMVQRSPLRRGMATYWFLKG
DSQ  ATGAAGAATGAAATACTGGAATTTCTGAACAGG------------------------------CATAATGGAGGGAAAACTGCAGAAATTGCAGAGGCGCTGGCGGTAACGGATTACCAGGCCCGCTATTACCTGTTATTACTGGAAAAAGCAGGTATGGTTCAGCGCTCACCATTAAGACGGGGCATGGCAACATACTGGTTTCTGAAAGGA
TRN  10010101100011000
//