EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04689 - S1FA)
FAM  PF04689
PID  S1FA
DES  DNA binding protein S1FA
IPR  IPR006779
ANO  3
ALN  71
AID  0.719862
APH  (S1FA_SPIOL/1-70:0.22556,S1FA2_ARATH/7-76:0.11406,S1FA1_ORYSA/6-76:0.32983);
ATP  (S1FA_SPIOL/1-70,S1FA2_ARATH/7-76,S1FA1_ORYSA/6-76);
ATL  0.66945
DNO  3
DLN  213
DID  0.660317
DPH  (S1FA_SPIOL/1-70:0.27188,S1FA2_ARATH/7-76:0.16534,S1FA1_ORYSA/6-76:0.26804);
DTP  (S1FA_SPIOL/1-70,S1FA2_ARATH/7-76,S1FA1_ORYSA/6-76);
DTL  0.70526
RID  0.719862
RPH  (S1FA_SPIOL/1-70:0.22556,S1FA2_ARATH/7-76:0.11406,S1FA1_ORYSA/6-76:0.32983);
RTP  (S1FA_SPIOL/1-70,S1FA2_ARATH/7-76,S1FA1_ORYSA/6-76);
RTL  0.66945
LNK  S1FA1_ORYSA/6-76:P42553:AL731641
LNK  S1FA2_ARATH/7-76:Q42337:AC006260
LNK  S1FA_SPIOL/1-70:P42552:X79543
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  S1FA_SPIOL/1-70
ASQ  MAVNEVE-AKGLNPGLIVLLVIGGLLLTFLVGNFILYTYAQKNLPPKKKKPISKKKMKRERLKQGVAPPGE
DSQ  ATGGCAGTTAACGAGGTTGAA---GCTAAAGGCCTCAATCCAGGCCTCATAGTTTTGTTGGTTATTGGAGGACTTCTATTAACCTTCCTAGTTGGGAATTTCATACTTTACACCTATGCTCAGAAGAACTTACCACCAAAGAAGAAGAAGCCTATTTCAAAGAAGAAGATGAAGAGGGAGAGGCTCAAGCAAGGTGTTGCACCTCCTGGAGAA
TRN  10010101110011000
NAM  S1FA2_ARATH/7-76
ASQ  AGKAVVE-AKGLNPGLIVLLVIGGLLVTFLIANYVMYMYAQKNLPPRKKKPLSKKKLKREKLKQGVPVPGE
DSQ  GCCGGAAAGGCGGTTGTTGAA---GCCAAAGGATTGAACCCTGGATTGATAGTGCTGCTTGTTATTGGAGGTCTGCTTGTGACATTTCTCATAGCCAATTACGTTATGTACATGTATGCTCAGAAGAATCTACCTCCAAGGAAGAAGAAGCCTCTTTCCAAAAAGAAGCTCAAGCGTGAGAAGCTGAAGCAGGGAGTCCCTGTGCCCGGCGAA
TRN  10010101100011011
NAM  S1FA1_ORYSA/6-76
ASQ  NNMIIEEVNKGLNPGTIVLLVVATLLILFFVGNYALYMYAQKTLPPRKKKPVSKKKLKREKLKQGVSAPGE
DSQ  AACAACATGATCATCGAGGAGGTCAACAAGGGCCTGAACCCTGGAACGATAGTCCTTCTTGTGGTTGCAACTCTCCTGATTCTTTTCTTTGTTGGAAACTATGCGCTCTACATGTATGCTCAGAAGACGCTTCCTCCTCGGAAGAAGAAGCCAGTCTCCAAGAAGAAGCTGAAGAGGGAAAAGCTGAAGCAGGGGGTTTCTGCACCCGGAGAG
TRN  10010101100011011
//