EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04657 - DUF606)
FAM  PF04657
PID  DUF606
DES  Protein of unknown function, DUF606
IPR  IPR006750
ANO  10
ALN  145
AID  0.273155
APH  ((((Q9RVB7_DEIRA/18-157:1.01396,(Q9HUZ5_PSEAE/6-145:0.77337,Q9HYS5_PSEAE/4-144:0.79808):0.14537):0.10417,(((Q97DD1_CLOAB/1-138:1.37352,YDCZ_ECOLI/4-143:1.06451):0.14208,Q9RVB6_DEIRA/7-144:1.15382):0.23537,Q98M54_RHILO/4-145:0.89753):0.06342):0.21606,Q9CJV1_PASMU/3-144:0.64675):0.29547,Q99VZ6_STAAM/2-144:0.78825,Q9CES9_LACLA/2-143:0.62560);
ATP  ((((Q9RVB7_DEIRA/18-157,(Q9HUZ5_PSEAE/6-145,Q9HYS5_PSEAE/4-144)),(((Q97DD1_CLOAB/1-138,YDCZ_ECOLI/4-143),Q9RVB6_DEIRA/7-144),Q98M54_RHILO/4-145)),Q9CJV1_PASMU/3-144),Q99VZ6_STAAM/2-144,Q9CES9_LACLA/2-143);
ATL  10.4888
DNO  10
DLN  435
DID  0.402067
DPH  (Q9HUZ5_PSEAE/6-145:0.41732,((Q9RVB6_DEIRA/7-144:0.44965,Q9RVB7_DEIRA/18-157:0.47850):0.08702,Q9HYS5_PSEAE/4-144:0.39521):0.06584,(((((Q97DD1_CLOAB/1-138:0.63496,Q99VZ6_STAAM/2-144:0.34205):0.14453,Q9CES9_LACLA/2-143:0.33379):0.25582,Q9CJV1_PASMU/3-144:0.31280):0.27918,YDCZ_ECOLI/4-143:0.63464):0.28003,Q98M54_RHILO/4-145:0.36097):0.09381);
DTP  (Q9HUZ5_PSEAE/6-145,((Q9RVB6_DEIRA/7-144,Q9RVB7_DEIRA/18-157),Q9HYS5_PSEAE/4-144),(((((Q97DD1_CLOAB/1-138,Q99VZ6_STAAM/2-144),Q9CES9_LACLA/2-143),Q9CJV1_PASMU/3-144),YDCZ_ECOLI/4-143),Q98M54_RHILO/4-145));
DTL  5.56612
RID  0.273155
RPH  ((((Q9RVB7_DEIRA/18-157:1.01396,(Q9HUZ5_PSEAE/6-145:0.77337,Q9HYS5_PSEAE/4-144:0.79808):0.14537):0.10417,(((Q97DD1_CLOAB/1-138:1.37352,YDCZ_ECOLI/4-143:1.06451):0.14208,Q9RVB6_DEIRA/7-144:1.15382):0.23537,Q98M54_RHILO/4-145:0.89753):0.06342):0.21606,Q9CJV1_PASMU/3-144:0.64675):0.29547,Q99VZ6_STAAM/2-144:0.78825,Q9CES9_LACLA/2-143:0.62560);
RTP  ((((Q9RVB7_DEIRA/18-157,(Q9HUZ5_PSEAE/6-145,Q9HYS5_PSEAE/4-144)),(((Q97DD1_CLOAB/1-138,YDCZ_ECOLI/4-143),Q9RVB6_DEIRA/7-144),Q98M54_RHILO/4-145)),Q9CJV1_PASMU/3-144),Q99VZ6_STAAM/2-144,Q9CES9_LACLA/2-143);
RTL  10.4888
LNK  Q97DD1_CLOAB/1-138:Q97DD1:AE007851
LNK  Q98M54_RHILO/4-145:Q98M54:BA000012
LNK  Q99VZ6_STAAM/2-144:Q99VZ6:BA000017
LNK  Q9CES9_LACLA/2-143:Q9CES9:AE006405
LNK  Q9CJV1_PASMU/3-144:Q9CJV1:AE006226
LNK  Q9HUZ5_PSEAE/6-145:Q9HUZ5:AE004894
LNK  Q9HYS5_PSEAE/4-144:Q9HYS5:AE004754
LNK  Q9RVB6_DEIRA/7-144:Q9RVB6:AE001961
LNK  Q9RVB7_DEIRA/18-157:Q9RVB7:AE001961
LNK  YDCZ_ECOLI/4-143:P76111:U00096
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9CJV1_PASMU/3-144
ASQ  VFYTIIALVAGVALASQAAINSQLAKAMGNePLVATFISFGTGTFLLLVISLLKTDL-IGH-LSSATQHAWWK-YIGGALGALVVFTTILLSPKMGITNMLFFIIVGQLIAAMVIDHYGLIHMPVREVNLFKFIGIAIVGIGLII
DSQ  GTTTTTTATACTATTATTGCACTGGTAGCGGGGGTTGCCTTAGCTTCTCAAGCGGCGATAAATTCACAGCTTGCCAAAGCCATGGGCAATgagCCTTTGGTTGCTACTTTTATTTCTTTTGGGACAGGTACCTTCTTATTGCTGGTGATTTCGTTATTAAAAACGGATTTA---ATTGGTCAT---CTTTCTAGCGCAACACAACATGCTTGGTGGAAA---TATATTGGCGGTGCGTTAGGCGCATTAGTCGTTTTTACCACGATTTTACTTTCTCCCAAAATGGGCATTACCAATATGTTGTTTTTTATTATTGTGGGTCAATTAATTGCGGCGATGGTGATTGACCATTATGGTCTGATTCATATGCCTGTGCGCGAAGTGAACTTGTTCAAGTTTATTGGGATAGCGATTGTTGGTATTGGGTTAATTATT
TRN  10010101100011000
NAM  Q98M54_RHILO/4-145
ASQ  VVWSLLGILSGAFIAIQAPINSQLARGLGL.PVAAAAFSFLSGAIVLGIIAVTVVKL-QGISLDWKAPAPWLF-VAGGMLGGFYVTLSTVLTPRIGAAALMAFLVAGQLLAGMLIDRVGFLGVAVREISLGRVAGAVMLLAGALL
DSQ  GTCGTCTGGTCGCTTCTCGGCATCCTGTCCGGCGCCTTCATTGCCATTCAGGCACCGATCAATTCGCAGCTGGCGCGCGGCCTGGGTCTC...CCGGTCGCGGCGGCTGCGTTTTCGTTCCTGTCGGGCGCGATCGTGCTCGGCATCATCGCCGTCACGGTGGTGAAGCTG---CAAGGCATTTCGCTCGACTGGAAGGCGCCGGCGCCCTGGCTGTTC---GTTGCCGGCGGCATGCTCGGCGGCTTCTATGTCACGCTCTCGACAGTCCTGACGCCGCGCATCGGCGCCGCTGCGCTGATGGCGTTCCTGGTGGCCGGCCAGTTGCTCGCCGGCATGCTCATCGATCGCGTCGGTTTCCTCGGCGTCGCGGTGCGTGAAATCTCGCTCGGCCGCGTCGCCGGCGCGGTGATGCTCTTGGCCGGAGCGCTGCTT
TRN  11011111101111111
NAM  Q9CES9_LACLA/2-143
ASQ  YIYLAFALVGGFLLANQNPINADLRKIVGS.PFLASGISNFVGSIFLGIITLVTSQTLFPS-FQFVGSHPAWI-WIGGVLGGIFLTSNVLLFPRLGAVQTVILPILGQILMGTLIDSFGWFHAMQLPMTLMRFLGIIITLAGVIV
DSQ  TATATTTACCTAGCTTTTGCTTTAGTTGGCGGTTTTTTACTTGCTAATCAAAATCCAATCAATGCGGATTTACGAAAAATTGTTGGCTCA...CCATTTTTAGCCTCTGGAATTTCCAACTTTGTTGGTTCGATTTTTTTAGGAATCATCACTTTAGTGACAAGTCAAACACTTTTTCCTAGT---TTTCAATTTGTTGGCTCACACCCAGCATGGATA---TGGATTGGTGGGGTTCTTGGTGGGATTTTCCTAACGTCTAATGTTTTACTTTTTCCAAGATTAGGAGCTGTCCAAACAGTGATTTTACCTATTTTGGGTCAAATATTGATGGGGACACTTATTGATTCATTTGGCTGGTTTCATGCCATGCAACTTCCGATGACTCTGATGCGCTTTTTGGGAATTATCATTACTTTAGCTGGTGTTATTGTC
TRN  10010101100011000
NAM  Q99VZ6_STAAM/2-144
ASQ  LLFYIIGVLVGMLIPIQTSVNSRLSLYTKS.PFYTSFISFSVGTICLIILNIIINPEVFTIHFYNNQSFN-YTWVVGGLLGVSFLTGNLLLLPKLGATLTVIATVAGQIIMGVIIDTFGLFGATIHDFNLIKAIGVLLLIVGIVI
DSQ  CTTCTTTTCTATATCATTGGTGTCCTAGTTGGAATGCTTATTCCTATCCAAACATCTGTCAATTCAAGACTATCACTGTATACTAAATCG...CCTTTCTATACTTCATTCATTTCATTTTCAGTTGGAACAATTTGTTTAATTATTTTAAATATCATTATCAATCCAGAAGTATTTACTATTCACTTTTACAATAATCAATCATTTAAC---TACACATGGGTAGTCGGTGGTTTGCTTGGGGTTAGCTTTTTAACTGGCAATTTATTGTTATTGCCAAAATTAGGTGCAACATTAACTGTAATTGCAACAGTTGCGGGTCAAATTATTATGGGTGTCATTATTGATACATTTGGCTTATTTGGCGCTACAATTCATGATTTTAATTTAATTAAAGCAATTGGAGTATTGTTACTCATTGTCGGCATCGTCATA
TRN  10010101100011000
NAM  Q9HYS5_PSEAE/4-144
ASQ  YLMVLMAVSVGGMVVLQAGSNALLGRLLGH.PLSASLTSLGVSLGVVSLGLLLVRVPLPATA--SLGGAPWWS-WLGGLFGAAYLTVAILVAPRLGAATFIACVVAGQMLVSALCDQFGWAGFPVRRLSWEGYLGLALVVAGVLL
DSQ  TATCTGATGGTACTGATGGCAGTTTCGGTGGGCGGCATGGTGGTGCTGCAGGCCGGCAGCAACGCCTTGCTCGGGCGCCTGCTCGGCCAT...CCGCTGAGCGCCAGCCTGACTTCGCTGGGCGTCAGCCTCGGGGTGGTCAGCCTGGGCCTGCTGCTGGTGCGGGTGCCGCTGCCGGCTACCGCC------AGCCTCGGCGGCGCGCCCTGGTGGAGC---TGGCTCGGCGGGCTGTTCGGCGCGGCCTACCTGACGGTGGCGATCCTGGTCGCGCCGCGCCTGGGTGCCGCCACTTTCATCGCGTGCGTGGTGGCCGGGCAGATGCTGGTCTCGGCGCTCTGCGACCAGTTCGGCTGGGCCGGTTTCCCGGTGCGCCGGTTGTCCTGGGAGGGCTATCTCGGCCTGGCGCTGGTGGTGGCGGGGGTATTGCTC
TRN  11011111101111111
NAM  Q9RVB7_DEIRA/18-157
ASQ  AGPLLLLIAAGALLPGQFAVNTALARQVGS.VVLAGTVSYGVGSLLLLLLLGLGRAT---PDWAAGRRAPAWA-WLGGVVGSAYVVGSVVLTRELGAGLATTLVIAAQLLTALLLDHFGWLGLTRRPLNRRRTAAALLALAGLAL
DSQ  GCTGGGCCGCTGCTGCTCCTCATCGCAGCCGGGGCTTTGCTGCCGGGGCAATTCGCGGTCAACACGGCGCTGGCCCGGCAAGTCGGCTCG...GTGGTGCTGGCGGGCACGGTGTCGTACGGCGTGGGCTCTTTGCTGCTGCTTTTGCTGCTGGGCCTGGGACGGGCCACC---------CCGGACTGGGCCGCCGGGCGCCGCGCTCCGGCCTGGGCG---TGGCTCGGCGGTGTGGTGGGCAGCGCCTACGTGGTGGGGAGCGTGGTGCTGACGCGCGAACTCGGGGCGGGGCTGGCGACCACTCTGGTTATCGCGGCGCAGCTTCTCACGGCCCTGCTGCTCGACCACTTCGGCTGGCTGGGCCTGACCCGGCGCCCGCTCAACCGGCGGCGGACAGCGGCGGCCCTCCTCGCGCTCGCCGGACTGGCGCTG
TRN  11011111101111111
NAM  Q9HUZ5_PSEAE/6-145
ASQ  WWLFVLPLLAGACLPLQAGINGQLAKQVSS.VLAAALISFFVGTLGLLALTLSQRE-FPGLA--ALRGLSWWH-WCGGFLGMFFIFIAAFAAPRIGALMFMVLVLAGQLGMAMSLDHFGWAGFREAPISALKLGGLALIGAGIWM
DSQ  TGGTGGCTGTTCGTCCTGCCCCTGCTCGCCGGCGCCTGCCTGCCGCTGCAGGCGGGGATCAACGGCCAGTTGGCCAAGCAGGTGTCCAGC...GTCCTCGCCGCGGCACTGATCTCGTTCTTCGTCGGCACCCTCGGGTTGCTCGCCCTGACCCTCTCGCAGCGCGAG---TTTCCCGGCCTGGCG------GCATTGCGCGGGCTGAGCTGGTGGCAC---TGGTGCGGCGGTTTCCTCGGCATGTTCTTCATCTTCATCGCCGCCTTCGCCGCACCGCGCATCGGCGCGCTGATGTTCATGGTGCTGGTGCTTGCCGGCCAGCTGGGCATGGCCATGAGCCTCGACCACTTCGGTTGGGCCGGCTTCCGCGAGGCACCGATCAGCGCGCTGAAGCTGGGCGGGTTGGCACTGATCGGCGCCGGCATCTGGATG
TRN  11011111101111111
NAM  Q9RVB6_DEIRA/7-144
ASQ  WLVLLGTLGAGLGLSAGGAFNLRLLRGLRV.PLAASLVNFLVGTTVLGVLWLLGVD-----GHRPDHWPPLWT-LLGGVLGAAYVTLNVTGAARYGVGVSTVAVTLGQMLGALLLGSRGWFGQTAQAPGAPAWLSAALLLGAVVL
DSQ  TGGCTGGTGCTGCTCGGCACCCTGGGGGCGGGGCTGGGCCTGTCGGCGGGGGGAGCGTTCAACCTGCGCCTTCTGCGTGGCCTGCGGGTG...CCGCTGGCGGCCAGCCTGGTCAACTTTCTGGTGGGAACCACGGTGCTGGGGGTGTTGTGGTTGCTGGGGGTGGAC---------------GGCCACCGCCCGGACCACTGGCCACCGCTGTGGACC---CTCCTCGGCGGCGTGCTCGGCGCTGCCTACGTCACCCTGAACGTCACTGGCGCCGCCCGCTACGGCGTGGGCGTCAGCACCGTGGCCGTTACCCTCGGGCAGATGCTCGGGGCCTTGCTGCTCGGGTCGCGCGGCTGGTTCGGACAGACGGCGCAGGCGCCCGGCGCCCCAGCCTGGCTCAGCGCGGCCCTGCTCCTCGGCGCGGTGGTGCTG
TRN  11011111101111111
NAM  YDCZ_ECOLI/4-143
ASQ  SLTLAFLIAAGIGLVVQNTLMVRITQTSST.ILIAMLLNSLVGIVLFVSILWFKQG-MAGFG-ELVSSVRWWT-LIPGLLGSFFVFASISGYQNVGAATTIAVLVASQLIGGLMLDIFRSHGVPLRAL-FGPICGAILLVVGAWL
DSQ  TCGCTCACCCTTGCTTTTTTGATTGCCGCCGGAATTGGTCTGGTTGTCCAGAACACGCTGATGGTGCGCATCACCCAGACCTCCTCTACC...ATTCTCATCGCCATGTTGCTGAACTCACTGGTGGGGATTGTGCTCTTTGTTTCTATTTTATGGTTTAAACAAGGC---ATGGCGGGGTTTGGC---GAACTGGTGTCCAGCGTGCGCTGGTGGACA---CTTATACCTGGCTTGCTGGGATCGTTTTTTGTCTTCGCCAGTATCAGCGGATATCAGAATGTGGGAGCGGCGACAACTATTGCTGTACTGGTCGCCAGTCAGCTGATTGGCGGTCTGATGCTGGATATCTTCCGCAGTCATGGCGTACCACTACGGGCGTTG---TTCGGCCCAATTTGTGGCGCAATTTTACTTGTGGTTGGCGCCTGGTTG
TRN  10010101100011000
NAM  Q97DD1_CLOAB/1-138
ASQ  MIGIISSIISGICMSLQGVFNTRLSEKIGL.WETNAWVQ---GTALLVTLVICFIY--GNGNLKMIGTANKLY-LTGGILGAIIIFTVMKGVSSLGPTCSISIILIAQLLSAAIIDFFGLFHTDRLTFDSTKIIGVVLMLAGIIC
DSQ  ATGATTGGTATTATATCTTCTATAATCTCTGGTATTTGCATGAGTCTTCAAGGAGTTTTCAATACAAGACTTAGTGAAAAAATTGGATTA...TGGGAAACAAATGCATGGGTTCAA---------GGCACTGCTCTTTTGGTTACCCTCGTAATTTGCTTCATATAT------GGGAATGGTAATTTAAAAATGATTGGAACTGCAAATAAACTTTAT---CTTACTGGTGGAATACTTGGTGCTATTATTATCTTTACAGTTATGAAAGGGGTGTCCTCTTTAGGTCCTACTTGTTCTATTAGTATAATATTAATTGCCCAACTACTGTCAGCAGCTATAATTGATTTTTTTGGATTATTTCATACTGATAGGCTTACCTTTGATTCAACAAAAATCATAGGTGTTGTTCTTATGCTTGCTGGTATAATTTGT
TRN  10010101100011000
//