EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04632 - FUSC)
FAM  PF04632
PID  FUSC
DES  Fusaric acid resistance protein conserved region
IPR  IPR006726
ANO  12
ALN  121
AID  0.257891
APH  ((((Q9HXC0_PSEAE/385-503:0.15440,Q9I570_PSEAE/395-513:0.52532):0.14606,FUSC_BURCE/228-346:0.58973):0.59875,(Q48403_KLEOX/5-123:0.95136,YJCQ_ECOLI/341-457:1.37442):0.23742):0.19704,((((YDHK_ECOLI/349-468:1.39057,Q9I151_PSEAE/372-490:0.71660):0.16868,Q98LS3_RHILO/365-483:0.51938):0.17970,(Q9I474_PSEAE/343-461:0.41504,Q9HYT9_PSEAE/341-459:0.42072):0.28592):0.17341,Q9I4A6_PSEAE/360-478:0.91045):0.18958,YHCP_ECOLI/344-461:1.11861);
ATP  ((((Q9HXC0_PSEAE/385-503,Q9I570_PSEAE/395-513),FUSC_BURCE/228-346),(Q48403_KLEOX/5-123,YJCQ_ECOLI/341-457)),((((YDHK_ECOLI/349-468,Q9I151_PSEAE/372-490),Q98LS3_RHILO/365-483),(Q9I474_PSEAE/343-461,Q9HYT9_PSEAE/341-459)),Q9I4A6_PSEAE/360-478),YHCP_ECOLI/344-461);
ATL  11.2632
DNO  11
DLN  363
DID  0.439308
DPH  ((((YHCP_ECOLI/344-461:0.74571,(YDHK_ECOLI/349-468:0.88733,((Q9I151_PSEAE/372-490:0.40392,((Q9HYT9_PSEAE/341-459:0.25708,Q9I474_PSEAE/343-461:0.22483):0.15485,Q98LS3_RHILO/365-483:0.44274):0.07782):0.07391,Q9I4A6_PSEAE/360-478:0.46582):0.07026):0.04704):0.06129,Q48403_KLEOX/5-123:0.60886):0.25504,Q9I570_PSEAE/395-513:0.21901):0.13161,Q9HXC0_PSEAE/385-503:0.12422,FUSC_BURCE/228-346:0.39931);
DTP  ((((YHCP_ECOLI/344-461,(YDHK_ECOLI/349-468,((Q9I151_PSEAE/372-490,((Q9HYT9_PSEAE/341-459,Q9I474_PSEAE/343-461),Q98LS3_RHILO/365-483)),Q9I4A6_PSEAE/360-478))),Q48403_KLEOX/5-123),Q9I570_PSEAE/395-513),Q9HXC0_PSEAE/385-503,FUSC_BURCE/228-346);
DTL  5.65065
RID  0.274025
RPH  (((((Q9I4A6_PSEAE/360-478:0.92913,((Q9HYT9_PSEAE/341-459:0.41225,Q9I474_PSEAE/343-461:0.42331):0.28903,(Q98LS3_RHILO/365-483:0.52556,(Q9I151_PSEAE/372-490:0.71464,YDHK_ECOLI/349-468:1.37251):0.16831):0.18244):0.13767):0.18138,YHCP_ECOLI/344-461:1.12652):0.23975,Q48403_KLEOX/5-123:1.18598):0.56679,FUSC_BURCE/228-346:0.57211):0.16173,Q9HXC0_PSEAE/385-503:0.14887,Q9I570_PSEAE/395-513:0.52643);
RTP  (((((Q9I4A6_PSEAE/360-478,((Q9HYT9_PSEAE/341-459,Q9I474_PSEAE/343-461),(Q98LS3_RHILO/365-483,(Q9I151_PSEAE/372-490,YDHK_ECOLI/349-468)))),YHCP_ECOLI/344-461),Q48403_KLEOX/5-123),FUSC_BURCE/228-346),Q9HXC0_PSEAE/385-503,Q9I570_PSEAE/395-513);
RTL  9.86437
LNK  FUSC_BURCE/228-346:P24128:S77489
LNK  Q48403_KLEOX/5-123:Q48403:D84271
LNK  Q98LS3_RHILO/365-483:Q98LS3:BA000012
LNK  Q9HXC0_PSEAE/385-503:Q9HXC0:AE004806
LNK  Q9HYT9_PSEAE/341-459:Q9HYT9:AE004753
LNK  Q9I151_PSEAE/372-490:Q9I151:AE004670
LNK  Q9I474_PSEAE/343-461:Q9I474:AE004556
LNK  Q9I4A6_PSEAE/360-478:Q9I4A6:AE004552
LNK  Q9I570_PSEAE/395-513:Q9I570:AE004522
LNK  YDHK_ECOLI/349-468:P76186:U00096
LNK  YHCP_ECOLI/344-461:P46481:U18997
LNK  YJCQ_ECOLI/341-457:P32715:
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  YHCP_ECOLI/344-461
ASQ  VKVESAERHHAMVNFWRTTLSCILGTLFWLWTGWTSGSGAMVMIAVVTSLAMRLPNPRMVAIDFIYGTLAALPLGLLYFLVIIPNTQQsMLLLCISLA---VLGFFLGIEVQKRRLGSMGA
DSQ  GTAAAAGTAGAGTCAGCCGAACGTCATCATGCAATGGTTAACTTCTGGCGAACCACACTTTCCTGCATTCTGGGCACGCTTTTCTGGCTGTGGACGGGCTGGACTTCCGGCAGTGGTGCAATGGTGATGATTGCGGTAGTGACGTCACTGGCAATGCGTTTGCCGAATCCACGCATGGTGGCGATCGACTTTATCTACGGGACGCTGGCCGCGCTGCCGTTAGGGCTGCTCTACTTTTTGGTGATTATCCCTAATACCCAACAGagcATGTTGCTGCTGTGCATTAGCCTGGCA---------GTGCTGGGATTCTTCCTCGGTATAGAAGTACAGAAACGGCGACTGGGCTCGATGGGGGCA
TRN  10010101100011000
NAM  FUSC_BURCE/228-346
ASQ  RYEPRTNKTAATIAGIRTATVILALGWFWIETAWPSGVMLVLNAAATCALASSAPRPTAMAAQMGMGTALAVCTGFLLTFGIYPRIDG.FVLLCAALAPLLAIGIY-MSLKPKLAGYGGAI
DSQ  CGCTACGAGCCGCGCACCAACAAAACGGCCGCCACGATCGCGGGGATCCGCACCGCGACGGTGATTCTCGCGCTCGGCTGGTTCTGGATCGAGACTGCGTGGCCGAGCGGCGTGATGCTGGTGCTGAACGCCGCGGCGACCTGCGCGCTCGCGTCGTCGGCGCCGCGCCCGACCGCGATGGCCGCGCAGATGGGGATGGGCACGGCGCTGGCCGTCTGCACCGGCTTCCTGCTGACGTTCGGCATCTACCCGCGGATCGACGGC...TTCGTCCTGCTGTGCGCGGCGCTCGCGCCGTTGCTCGCGATCGGCATCTAC---ATGTCGCTGAAGCCGAAGCTCGCCGGCTACGGCGGGGCTATC
TRN  11011101101011011
NAM  Q9I570_PSEAE/395-513
ASQ  SFVARANPVAALVAGARSALMIGLLGTFWIQTSWPHGGTFALTAVLISALSSTSPNPGRLSLQLTLGTLAGACTGLFVLLYLLPHVDG.FPMLLCCLLPVFAVGAL-LLWRPQWNGYGVGL
DSQ  AGCTTCGTCGCCCGCGCCAACCCGGTCGCCGCGCTGGTCGCCGGAGCGCGTAGCGCGCTGATGATCGGCCTGCTCGGCACGTTCTGGATCCAGACCTCCTGGCCCCACGGCGGCACCTTCGCCCTCACCGCGGTACTGATCTCGGCGCTCTCCTCGACCTCGCCGAATCCCGGCCGGTTGTCGCTGCAACTCACCCTCGGGACCCTCGCCGGGGCCTGCACCGGGCTGTTCGTGCTGCTCTACCTGCTACCCCACGTGGACGGT...TTCCCGATGCTGCTCTGCTGCCTGCTGCCGGTCTTCGCGGTCGGCGCCCTG---CTGCTCTGGCGGCCGCAGTGGAACGGCTACGGCGTCGGCCTA
TRN  11011111101111111
NAM  Q9HXC0_PSEAE/385-503
ASQ  AFTAKANAVAAAVAGMRTGLMILLFGCFWIYSTWPSGGTFALNAVAVSALASAAPNPKKVAMQMAIGTMAAALLGFSEMFFVYPHIDG.FPLLCLVLAPVFALGAF-ISSRPQWAGYGLGL
DSQ  GCCTTCACCGCCAAGGCCAACGCGGTGGCGGCGGCAGTGGCGGGGATGCGCACCGGGTTGATGATCCTGCTGTTCGGCTGTTTCTGGATCTACAGCACCTGGCCCAGCGGCGGCACCTTCGCCCTCAACGCGGTGGCGGTCTCGGCGTTGGCCTCGGCGGCGCCGAACCCGAAGAAGGTCGCCATGCAGATGGCCATCGGCACCATGGCGGCGGCGCTGCTCGGCTTCAGCGAGATGTTCTTCGTCTACCCGCATATCGACGGT...TTCCCGCTGCTATGCCTGGTACTGGCGCCGGTGTTCGCCCTCGGCGCGTTC---ATCTCCTCGCGGCCGCAGTGGGCCGGCTACGGTCTCGGCCTG
TRN  11011111101111111
NAM  Q98LS3_RHILO/365-483
ASQ  ALVVHRDYPGASRNAVRAALATLLVAAFWLTTKWSEAAGTVILVAVVSSLFAARPDPVQVSWGFFKGTLLALPFAFLIGQIALPALPG.FGWFVLFVVPILVPTAL-GMANPRYVGIATAF
DSQ  GCGCTGGTGGTGCACCGCGACTACCCCGGCGCATCGCGCAATGCCGTGCGTGCCGCCCTTGCCACCCTGCTGGTCGCGGCCTTCTGGCTGACGACGAAATGGTCCGAGGCGGCGGGCACGGTCATTCTCGTTGCCGTCGTATCCAGCCTTTTCGCCGCTCGCCCCGATCCGGTGCAGGTGTCCTGGGGCTTCTTCAAGGGCACGCTGCTGGCTTTGCCCTTTGCCTTTCTCATCGGCCAGATCGCATTGCCTGCTTTGCCCGGC...TTCGGCTGGTTCGTGCTGTTCGTTGTGCCGATCCTGGTGCCGACGGCGCTG---GGCATGGCCAATCCGCGCTATGTCGGCATAGCCACGGCCTTC
TRN  10010101100011011
NAM  Q9I474_PSEAE/343-461
ASQ  AIAWHRDIERGVLFGLRSALAFLCVAAFWLASAWPSGLGAVSITGVVLSLFASRDNPAQAGLNFLRGILLSIPLAGFVALFYLPGVDG.FPLLCLGLGVPLFFAAL-CVNRASLAGIASPF
DSQ  GCCATCGCCTGGCACCGGGACATCGAGCGCGGCGTGCTGTTCGGCCTGCGCAGCGCCCTGGCGTTCCTCTGCGTGGCCGCGTTCTGGCTGGCCAGCGCCTGGCCGAGCGGGTTGGGCGCGGTGTCGATCACCGGCGTGGTGCTGAGTCTCTTCGCCAGCCGCGACAACCCGGCCCAGGCCGGCCTGAACTTCCTTCGCGGGATCCTCCTGTCGATCCCGCTGGCCGGCTTCGTCGCACTGTTCTACCTGCCCGGCGTGGACGGC...TTCCCGCTGCTCTGCCTGGGCCTGGGCGTACCGCTGTTCTTCGCCGCGCTG---TGCGTGAACCGGGCGAGCCTGGCCGGGATCGCCTCGCCGTTC
TRN  11011111101111111
NAM  Q9HYT9_PSEAE/341-459
ASQ  TLSWHRDLQMALFYGTRSALALLGLSVYWIYTAWPAASGAMLLAAVVCSLFANRDNAVAIGLSFLRGIVYAIPAAMLVSQWLLPQWNG.FPLLCLAMGVPLFFATL-GMAVPVTAGTATSF
DSQ  ACCCTGTCCTGGCACCGCGACCTGCAGATGGCGCTGTTCTACGGTACGCGTAGCGCCCTGGCGTTGCTCGGGCTGTCGGTCTACTGGATCTATACCGCGTGGCCGGCGGCGTCCGGCGCGATGCTGCTGGCGGCGGTGGTGTGCAGCCTGTTCGCCAACCGCGACAACGCGGTGGCCATCGGCCTGAGCTTCCTGCGCGGCATCGTCTACGCGATCCCGGCGGCGATGCTGGTCAGCCAGTGGCTGCTGCCGCAGTGGAATGGC...TTCCCGCTGCTCTGCCTGGCGATGGGCGTGCCGCTGTTCTTCGCCACCCTG---GGCATGGCCGTACCGGTTACCGCCGGCACCGCCACCTCGTTC
TRN  11011111101111111
NAM  Q9I151_PSEAE/372-490
ASQ  AQALHLDWALASMNAVRAFVALSCAAWLWITSAWNGALSSLLLVGVMCSLMATFPRPLLAAQNFLRGLLLAILISAALLFVLLPASAD.FEWLALWMALLLYVVAV-GLSSPLSAGIAMGI
DSQ  GCGCAGGCGCTGCACCTGGACTGGGCGCTGGCCTCGATGAACGCCGTGCGCGCTTTCGTCGCCTTGTCCTGCGCCGCCTGGCTGTGGATCACCAGCGCCTGGAACGGCGCCCTCAGCAGCCTGCTGCTGGTCGGCGTGATGTGCTCGCTGATGGCGACCTTCCCGCGTCCGCTGCTGGCGGCGCAGAACTTCCTGCGCGGGCTGCTGCTGGCGATCCTGATCTCGGCGGCGCTGCTGTTCGTGCTGTTACCGGCATCCGCCGAC...TTCGAGTGGCTGGCGTTGTGGATGGCGTTGCTGCTGTACGTGGTCGCGGTC---GGCCTGAGCAGCCCGCTGAGCGCCGGGATCGCCATGGGCATC
TRN  11011111101111110
NAM  Q9I4A6_PSEAE/360-478
ASQ  PAAFHRHYREALRNGARAWLAMLVGGALWFLSGWDQGPTLLAVLGPYCTLLAASPFPAEGTRNFIRGTLYAIPAALLCKFLLLPLING.FPLLLLCLAFFWSFGIQ-ATTVPRRALQGIAY
DSQ  CCAGCGGCCTTCCATCGACATTACCGCGAGGCCTTGCGCAACGGCGCGCGAGCCTGGCTGGCGATGCTGGTCGGCGGCGCCCTGTGGTTCCTCAGCGGGTGGGACCAGGGGCCGACCCTGCTGGCGGTGCTCGGCCCCTACTGCACGCTGCTGGCAGCCTCGCCCTTTCCCGCCGAGGGCACGCGCAATTTCATTCGCGGCACGCTCTACGCGATACCTGCCGCATTGCTCTGCAAATTCCTTCTGCTACCGCTGATCAACGGT...TTTCCATTGCTGCTGCTGTGCCTCGCCTTCTTCTGGTCGTTCGGTATCCAG---GCCACCACAGTGCCCAGGCGGGCGTTGCAGGGAATCGCCTAC
TRN  10010101100011011
NAM  Q48403_KLEOX/5-123
ASQ  DTFSIAIPSSAARTALGAFVIILSGCLLWIYSAWPDGGTAVSILGVCCTLFGSFDTPAPHIVKYIIGSVWGVVISLIYSFALLPPLSD.FPVLVAVLAPVYLLAGS-LQARPPTTFMAMGI
DSQ  GATACGTTTTCCATCGCGATCCCCTCCAGCGCCGCCCGCACGGCGCTGGGCGCTTTTGTCATCATTCTGAGCGGCTGTCTGCTATGGATTTACTCTGCCTGGCCCGATGGCGGCACGGCGGTGTCGATTCTCGGGGTTTGCTGCACGCTGTTTGGCAGTTTCGACACGCCGGCCCCGCATATTGTGAAATATATTATCGGCTCTGTCTGGGGCGTAGTGATAAGCCTTATCTATAGCTTCGCCCTGCTTCCTCCGCTCAGCGAT...TTCCCCGTGCTGGTGGCGGTGCTTGCCCCGGTCTATCTGCTTGCCGGATCG---CTGCAGGCGCGGCCCCCCACGACCTTTATGGCCATGGGGATC
TRN  10010101100011011
NAM  YDHK_ECOLI/349-468
ASQ  GLARHTDNAEAMWSGLRTFCTLMMIGAWSIASQWDAGANALTLAAISCVLYSAVAAPFKSLSLLMRTLVLLSLFSFVVKFGLMVQISD.LWQFLLFLFPLLATMQLLKLQMPKFAALWGQL
DSQ  GGCCTGGCTCGTCATACCGATAACGCCGAAGCTATGTGGAGCGGGCTGCGTACATTTTGTACGTTGATGATGATTGGCGCATGGAGTATTGCTTCGCAATGGGATGCCGGTGCCAATGCATTAACGCTGGCAGCAATTAGCTGCGTACTCTACTCCGCCGTCGCAGCACCGTTTAAGTCGTTGTCACTTCTGATGCGCACGCTGGTGTTACTTTCGCTATTCAGCTTTGTGGTCAAATTTGGTCTGATGGTCCAGATTAGCGAT...CTGTGGCAATTTTTACTGTTTCTCTTTCCACTGCTGGCGACAATGCAGCTTCTTAAATTGCAGATGCCAAAATTTGCCGCATTGTGGGGGCAACTG
TRN  11011101101011000
NAM  YJCQ_ECOLI/341-457
ASQ  AADAFTNPDY-MRYAVKTLLACLICYTFYSGVDWEGIHTCMLTCVIVAN--PNVGSSYQKMVLRFGGAFCGAILALLFTLLVMPWLDN.IVELLFVLAPIFLLGAWIATSSERSSYIGTQM
//