EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04622 - ERG2_Sigma1R)
FAM  PF04622
PID  ERG2_Sigma1R
DES  ERG2 and Sigma1 receptor like protein
IPR  IPR006716
ANO  7
ALN  230
AID  0.396283
APH  (((ERG2_YEAST/1-221:0.44602,ERG2_SCHPO/2-219:0.40622):0.13013,(ERG2_USTMA/21-241:0.36271,(ERG2_NEUCR/42-256:0.18013,ERG2_MAGGR/7-221:0.11122):0.14389):0.15679):0.56802,O02109_CAEEL/6-200:1.16585,Q9R0C9_RAT/7-219:0.69377);
ATP  (((ERG2_YEAST/1-221,ERG2_SCHPO/2-219),(ERG2_USTMA/21-241,(ERG2_NEUCR/42-256,ERG2_MAGGR/7-221))),O02109_CAEEL/6-200,Q9R0C9_RAT/7-219);
ATL  4.36475
DNO  7
DLN  690
DID  0.480124
DPH  (((ERG2_YEAST/1-221:0.35073,ERG2_SCHPO/2-219:0.32710):0.17561,(ERG2_USTMA/21-241:0.25582,(ERG2_NEUCR/42-256:0.15583,ERG2_MAGGR/7-221:0.13339):0.10793):0.15384):0.28797,O02109_CAEEL/6-200:0.71969,Q9R0C9_RAT/7-219:0.55146);
DTP  (((ERG2_YEAST/1-221,ERG2_SCHPO/2-219),(ERG2_USTMA/21-241,(ERG2_NEUCR/42-256,ERG2_MAGGR/7-221))),O02109_CAEEL/6-200,Q9R0C9_RAT/7-219);
DTL  3.21937
RID  0.396283
RPH  (((ERG2_YEAST/1-221:0.44602,ERG2_SCHPO/2-219:0.40622):0.13013,(ERG2_USTMA/21-241:0.36271,(ERG2_NEUCR/42-256:0.18013,ERG2_MAGGR/7-221:0.11122):0.14389):0.15679):0.56802,O02109_CAEEL/6-200:1.16585,Q9R0C9_RAT/7-219:0.69377);
RTP  (((ERG2_YEAST/1-221,ERG2_SCHPO/2-219),(ERG2_USTMA/21-241,(ERG2_NEUCR/42-256,ERG2_MAGGR/7-221))),O02109_CAEEL/6-200,Q9R0C9_RAT/7-219);
RTL  4.36475
LNK  ERG2_MAGGR/7-221:P33281:Z22775
LNK  ERG2_NEUCR/42-256:Q92254:U59671
LNK  ERG2_SCHPO/2-219:P87113:Z95334
LNK  ERG2_USTMA/21-241:P32360:Z17311
LNK  ERG2_YEAST/1-221:P32352:M74037
LNK  O02109_CAEEL/6-200:O02109:AF000266
LNK  Q9R0C9_RAT/7-219:Q9R0C9:AF067769
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9R0C9_RAT/7-219
ASQ  RRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAG-------LDHELAFSRLIVELRRLHPG-HVLP-----DEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRYWAEISDTIISGTFHQWREGTTK--SEVYYPGETVVHGPGEATAVEWG-.PNTWMVEYGRGVIPSTLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLF
DSQ  CGGCGGTGGGCATGGATCACCCTGTTTCTGACTATTGTGGCGGTGCTGATCCAGGCGGTCTGGCTGTGGCTGGGTACTCAGAGCTTCGTCTTCCAGAGAGAAGAGATAGCTCAGCTTGCTCGACAGTACGCAGGG---------------------CTGGACCATGAGCTGGCCTTCTCTCGGCTGATCGTGGAGCTGCGGAGGCTGCACCCAGGC---CACGTGCTGCCG---------------GATGAGGAGCTGCAGTGGGTGTTTGTGAACGCGGGCGGCTGGATGGGCGCCATGTGTCTTTTGCACGCCTCGCTGTCTGAGTACGTGCTGCTCTTCGGCACCGCCCTGGGCTCCCATGGCCATTCGGGACGATACTGGGCTGAGATTTCAGATACCATCATCTCTGGCACTTTCCACCAGTGGAGAGAGGGCACCACAAAA------AGTGAGGTCTATTACCCAGGAGAGACGGTTGTCCATGGACCTGGAGAGGCAACAGCTGTGGAGTGGGGA---...CCAAACACGTGGATGGTGGAGTATGGCCGGGGTGTTATTCCGTCTACCCTGGCATTTGCACTTAGTGACACTATTTTCAGCACCCAGGACTTCCTCACCCTCTTCTATACCCTTCGCGCCTATGCCCGGGGCCTCCGGCTTGAGCTCACCACCTACCTCTTT
TRN  10010101100011001
NAM  ERG2_YEAST/1-221
ASQ  MKFFPLLLLIGVVGYIMNVLFTTWLPTNYMFDPKTLNEICNSVISKHNAAEGLSTEDLLQDVRDALASHYGDEYI-----NRYVKEEWVFNNAGGAMGQMIILHASVSEYLILFGTAVGTEGHTGVHFADDYFTILHGTQIAALPYATE--AEVYTPGMTHHLKKGYAKQYSMP-.GGSFALELAQGWIPCMLPFGFLDTFSSTLDLYTLYRTVYLTARDMGKNLLQNKK
DSQ  ATGAAGTTTTTCCCACTCCTTTTGTTGATTGGTGTTGTAGGCTACATTATGAACGTATTGTTCACTACCTGGTTGCCAACCAATTACATGTTCGATCCAAAAACTTTGAACGAAATATGTAACTCGGTGATTAGCAAACACAACGCAGCAGAAGGTTTATCCACTGAAGACCTGTTACAGGATGTCAGAGACGCACTTGCCTCTCATTACGGGGACGAATACATC---------------AACAGGTACGTCAAAGAAGAATGGGTCTTCAACAATGCTGGTGGTGCGATGGGCCAAATGATCATCCTACACGCTTCCGTATCCGAGTACTTAATTCTATTCGGAACCGCTGTTGGTACTGAAGGGCACACAGGTGTTCACTTTGCTGACGACTATTTTACCATCTTACATGGTACGCAAATCGCAGCATTGCCATATGCCACTGAA------GCCGAAGTTTACACTCCTGGTATGACTCATCACTTGAAGAAGGGATACGCCAAGCAATACAGCATGCCA---...GGTGGTTCCTTTGCCCTTGAATTGGCTCAAGGCTGGATTCCATGTATGTTGCCATTCGGGTTTTTGGACACTTTCTCCAGTACTCTTGATTTATACACTCTATATAGAACTGTCTACCTGACTGCCAGGGACATGGGTAAGAACTTGTTGCAAAACAAAAAG
TRN  10010101100011010
NAM  ERG2_SCHPO/2-219
ASQ  KLTKFLTVFIPFIAGLIYYIQKYHLRSFYQFDPAKLQELSKQSIALYA----NDTKALLYDLSDRLVAEYGD-LITP-----VNQDEWVHNNAGGAMGTMFILHASFSEYLIFFGTPIGTEGHSGVHMADDYFTILRGRQLAASANDLE--ARVYLPGDQHVHPWGHTAQYSMPSgEPCFALELAQGWIVSMLPFGFMDGLFSTIDFGTLYKTVYFTAGRMLKSVLMGKF
DSQ  AAATTGACAAAGTTTTTAACTGTGTTCATTCCTTTTATTGCTGGATTGATTTATTATATACAAAAATATCATCTTCGTTCCTTCTATCAATTTGATCCAGCAAAGTTGCAGGAGCTATCTAAGCAGTCTATTGCTTTATACGCA------------AATGATACCAAAGCTCTTCTTTACGACTTGAGCGACAGACTCGTTGCTGAATACGGAGAC---TTAATTACTCCT---------------GTGAATCAAGATGAATGGGTTCACAACAATGCTGGTGGTGCTATGGGTACAATGTTTATCTTGCATGCTTCCTTTTCTGAGTACTTGATTTTCTTTGGCACGCCTATCGGCACCGAGGGACATTCTGGTGTTCATATGGCTGACGATTATTTCACTATTTTACGTGGCCGTCAACTTGCTGCTTCTGCTAATGACCTTGAG------GCTCGTGTTTATCTTCCTGGTGACCAACATGTTCATCCTTGGGGTCACACTGCTCAGTATAGCATGCCGTCTggtGAACCTTGTTTTGCTCTTGAACTAGCTCAAGGATGGATTGTATCAATGCTTCCCTTTGGATTTATGGATGGTTTATTCTCCACCATTGATTTCGGAACTTTATACAAAACCGTTTATTTCACTGCGGGAAGGATGTTGAAAAGTGTTTTAATGGGAAAATTC
TRN  10010101110011000
NAM  ERG2_USTMA/21-241
ASQ  RSWIIVSAALVGFCALIAALDS-IRSSFYIFDHKAIYKIASTAVANHPG----NATAIFDDVLDNLRA-DPKLAPYINKNHFSDESEWMFNNAGGAMGSMFIIHASVTEYLIFFGTPVGTEGHTGRHTADDYFNILTGNQYAFPAGALK--AEHYPAGSVHHLRRGTVKQYMMPE.DGCWALELAQGWIPPMLPFGLADVLSSTLDLPTFGITVWITAREMVGNLLIGKF
DSQ  CGCAGCTGGATAATTGTCTCAGCTGCGCTCGTTGGCTTCTGCGCTCTCATCGCCGCTCTCGATTCG---ATCCGATCCAGCTTCTACATCTTTGACCACAAGGCAATCTACAAGATCGCATCGACTGCGGTCGCCAACCATCCAGGC------------AATGCGACGGCCATCTTTGATGATGTCCTCGACAACCTTCGTGCC---GACCCCAAGCTCGCGCCTTACATCAACAAGAATCATTTCAGCGACGAGTCAGAATGGATGTTCAACAATGCCGGTGGTGCTATGGGTAGCATGTTCATCATTCATGCTTCCGTCACCGAGTACCTGATCTTCTTTGGCACTCCCGTCGGAACCGAGGGTCACACTGGTCGTCACACAGCCGATGACTACTTCAACATCCTTACCGGTAACCAATACGCTTTCCCAGCTGGTGCGCTCAAG------GCGGAGCACTACCCTGCCGGATCAGTGCACCATCTTCGCCGCGGAACGGTCAAGCAGTACATGATGCCTGAA...GACGGCTGCTGGGCGCTCGAGCTTGCTCAGGGCTGGATCCCACCCATGCTTCCCTTTGGTCTCGCCGATGTGCTCAGCTCGACGCTCGACCTGCCCACCTTTGGTATCACTGTCTGGATCACTGCACGAGAAATGGTTGGCAATCTGCTCATCGGCAAGTTT
TRN  10010111100111001
NAM  ERG2_NEUCR/42-256
ASQ  GWLKFFAILFALVAPIAYVLEQRL-ESFYVFDTEHLHDLSKRAISRHG----NDTKAIVKYIVDELNDRNGV-APYV-----NNDEEWVFNNAGGAMGAMYIIHASITEYLIIFGTAIGTEGHTGRHTADDYFHILTGTQTAYVPGEYE--PEVYPPGSVHHLVRGTVKQYRMPE.-SCFALEYPRGWIPPMLFFGYADTLSSTLDFPTLWRTSVITGREMISNLLKGKF
DSQ  GGCTGGCTCAAGTTCTTCGCCATCTTGTTCGCCCTAGTTGCGCCTATCGCCTACGTCCTGGAGCAGCGTCTC---GAGTCCTTCTACGTCTTCGATACTGAGCACCTTCACGATCTGTCCAAGCGCGCCATCAGCCGCCACGGC------------AACGACACCAAGGCTATTGTCAAGTACATTGTCGACGAGCTGAACGACCGCAACGGCGTT---GCGCCCTACGTC---------------AACAACGATGAGGAGTGGGTGTTCAACAACGCTGGTGGTGCCATGGGTGCTATGTACATCATCCACGCCTCCATCACCGAGTACCTGATTATCTTTGGCACTGCCATCGGTACTGAGGGTCACACCGGCCGCCACACCGCCGACGACTACTTCCACATCCTCACCGGCACTCAGACTGCCTACGTCCCCGGCGAGTACGAG------CCTGAGGTCTACCCTCCCGGTTCCGTTCACCACCTCGTCCGCGGTACCGTCAAGCAGTACAGGATGCCCGAG...---AGCTGCTTCGCGCTCGAGTATCCGCGCGGCTGGATCCCTCCCATGCTGTTCTTCGGTTATGCCGATACCCTCAGCAGCACGCTCGATTTCCCTACCCTCTGGCGCACCTCCGTCATCACCGGCCGCGAGATGATTAGCAACTTGCTCAAGGGCAAGTTC
TRN  10010101100011011
NAM  ERG2_MAGGR/7-221
ASQ  GFLRFVAVLLAVVSPLVYLAEQRL-ESFYVFDHKHLHELSTQAIAQHG----NNTRAIVGHIVDELRARPET-TKYI-----SVQEEWVFNNAGGAMGGMYIIHASVTEYLIIFGTAIGTEGHTGRHTADDYFNILTGEQWAYVPGEYE--PEVYPAGSVHHLRRGTVKQYKMPE.-GCFALEYARGWIPPMLFFGFADGLSSTLDFPTLWQTTVVTGREMLGNLMLGKF
DSQ  GGGTTCCTCCGCTTCGTGGCTGTCCTCCTGGCCGTCGTCTCGCCGCTCGTTTACCTTGCCGAGCAGCGCCTC---GAATCCTTCTACGTCTTTGACCACAAGCACCTGCACGAGCTGTCCACCCAGGCCATCGCCCAGCACGGC------------AACAACACGCGCGCCATTGTAGGCCACATTGTCGACGAGCTGCGCGCCCGCCCCGAGACG---ACCAAGTACATC---------------AGCGTTCAGGAGGAATGGGTTTTTAACAATGCCGGCGGTGCCATGGGTGGCATGTACATCATCCATGCCAGCGTCACCGAGTACCTCATCATCTTCGGCACCGCCATCGGAACTGAGGGCCACACCGGCCGCCACACCGCCGACGACTACTTCAACATCCTGACCGGCGAGCAGTGGGCTTACGTTCCCGGAGAGTACGAG------CCCGAGGTCTACCCTGCCGGCAGCGTCCACCACCTCCGCCGCGGCACCGTCAAGCAGTACAAGATGCCTGAG...---GGCTGCTTCGCTCTCGAGTACGCCCGCGGCTGGATCCCGCCCATGCTATTCTTTGGCTTTGCCGACGGCCTCAGCAGCACCCTCGACTTCCCCACCCTGTGGCAAACCACTGTGGTCACTGGTCGTGAGATGCTGGGCAACTTGATGCTTGGCAAGTTT
TRN  11011111101111111
NAM  O02109_CAEEL/6-200
ASQ  SKLRYLLLFYAVF----QAAQFGLRWKSYDISPKQFKTIAGKAAA---A---PTISQSISTLTSGMRTYYEP--IMP--SHF----EWHAIQLGGLTLRMYPMLTAFTEFAAAFSAPFPTSGRPGLHWANTTCTVLKGKVSRFNDGTQDETSENFASGAAFRHGQFESHVYSFE-.KDTYVACYGRGFLP----------LSSTV-----HVTSGISLGEPLSVIQFYMK
DSQ  TCAAAGCTTCGGTATCTTCTGCTCTTCTACGCAGTCTTC------------CAGGCTGCTCAATTTGGCCTCCGCTGGAAGTCTTATGACATCTCGCCGAAGCAGTTCAAGACTATCGCTGGAAAGGCTGCTGCT---------GCT---------CCAACAATCTCCCAGTCAATTTCCACATTGACGTCTGGAATGCGCACTTATTACGAGCCA------ATCATGCCA------AGTCACTTC------------GAATGGCACGCTATTCAGTTGGGAGGCCTCACTTTAAGGATGTACCCAATGCTGACCGCTTTCACCGAGTTCGCCGCCGCCTTCTCCGCTCCGTTCCCAACTTCAGGACGCCCGGGGCTCCATTGGGCAAATACGACGTGCACCGTGTTGAAAGGAAAAGTCAGCCGATTCAATGACGGAACTCAGGACGAGACGTCGGAGAACTTTGCTTCGGGAGCCGCTTTCAGGCACGGACAGTTCGAGTCCCACGTGTACAGCTTCGAG---...AAGGACACCTACGTCGCGTGCTACGGTCGCGGCTTCCTCCCA------------------------------CTCTCCTCCACCGTC---------------CACGTCACCTCTGGAATCTCACTCGGCGAGCCACTCTCGGTCATTCAATTCTACATGAAG
TRN  10010101100011000
//