EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04528 - Adeno_E4_34)
FAM  PF04528
PID  Adeno_E4_34
DES  Adenovirus early E4 34 kDa protein conserved region
IPR  IPR007615
ANO  12
ALN  165
AID  0.29692
APH  ((((Q98VK6_9ADEN/107-247:0.51407,(((O71108_ADEB3/101-244:0.79273,O71106_ADEB3/68-210:0.49687):0.68503,E434_ADEM1/130-283:1.37451):0.26876,(E434_ADE12/131-276:0.27678,(E434_ADE40/132-277:0.37917,(E434_ADE09/131-278:0.20336,E434_ADE02/141-286:0.21192):0.13009):0.00000):0.57366):0.23881):0.07839,Q84211_ADEP3/1-157:0.62147):0.22114,Q98VN6_9ADEN/104-245:0.70295):1.01774,E434_ADECC/100-251:0.10052,E434_ADECT/94-245:0.12345);
ATP  ((((Q98VK6_9ADEN/107-247,(((O71108_ADEB3/101-244,O71106_ADEB3/68-210),E434_ADEM1/130-283),(E434_ADE12/131-276,(E434_ADE40/132-277,(E434_ADE09/131-278,E434_ADE02/141-286))))),Q84211_ADEP3/1-157),Q98VN6_9ADEN/104-245),E434_ADECC/100-251,E434_ADECT/94-245);
ATL  9.15223
DNO  11
DLN  495
DID  0.414834
DPH  (((((E434_ADE40/132-277:0.26686,E434_ADE09/131-278:0.32241):0.14027,E434_ADE12/131-276:0.22432):0.23515,(O71108_ADEB3/101-244:0.59503,O71106_ADEB3/68-210:0.34437):0.55025):0.07377,((Q84211_ADEP3/1-157:0.57450,Q98VK6_9ADEN/107-247:0.37359):0.09166,(Q98VN6_9ADEN/104-245:0.43625,E434_ADEM1/130-283:0.78274):0.19603):0.14992):0.58781,E434_ADECC/100-251:0.03666,E434_ADECT/94-245:0.13218);
DTP  (((((E434_ADE40/132-277,E434_ADE09/131-278),E434_ADE12/131-276),(O71108_ADEB3/101-244,O71106_ADEB3/68-210)),((Q84211_ADEP3/1-157,Q98VK6_9ADEN/107-247),(Q98VN6_9ADEN/104-245,E434_ADEM1/130-283))),E434_ADECC/100-251,E434_ADECT/94-245);
DTL  6.11377
RID  0.286559
RPH  ((((Q98VK6_9ADEN/107-247:0.49532,(((O71108_ADEB3/101-244:0.78823,O71106_ADEB3/68-210:0.50071):0.66879,E434_ADEM1/130-283:1.38650):0.27083,((E434_ADE40/132-277:0.33530,E434_ADE09/131-278:0.29780):0.04777,E434_ADE12/131-276:0.28228):0.55491):0.23029):0.09509,Q84211_ADEP3/1-157:0.61280):0.22469,Q98VN6_9ADEN/104-245:0.70629):1.01364,E434_ADECC/100-251:0.09873,E434_ADECT/94-245:0.12507);
RTP  ((((Q98VK6_9ADEN/107-247,(((O71108_ADEB3/101-244,O71106_ADEB3/68-210),E434_ADEM1/130-283),((E434_ADE40/132-277,E434_ADE09/131-278),E434_ADE12/131-276))),Q84211_ADEP3/1-157),Q98VN6_9ADEN/104-245),E434_ADECC/100-251,E434_ADECT/94-245);
RTL  8.90284
LNK  E434_ADE02/141-286:P03239:
LNK  E434_ADE09/131-278:P89083:S82508
LNK  E434_ADE12/131-276:P36710:X73487
LNK  E434_ADE40/132-277:Q64865:L19443
LNK  E434_ADECC/100-251:Q65962:U55001
LNK  E434_ADECT/94-245:P87568:U77082
LNK  E434_ADEM1/130-283:P23125:M37187
LNK  O71106_ADEB3/68-210:O71106:AF030154
LNK  O71108_ADEB3/101-244:O71108:AF030154
LNK  Q84211_ADEP3/1-157:Q84211:AF083132
LNK  Q98VK6_9ADEN/107-247:Q98VK6:AF289262
LNK  Q98VN6_9ADEN/104-245:Q98VN6:AF289262
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  E434_ADEM1/130-283
ASQ  RELVVQKFLLGTRFNEYYPQYRVHANRYVNPGLEYVGSVWC-GKHFIYVRADGAEFA-----RLKGLRARLGQGVLFCESLLSCYVVIVCQQCACPPTDAQVDHCMRLLSFTLRRWQNLLLGRSGSS-----PLIPGFDIPRNRTERLRQRMLHRFYSYRTPIYR
DSQ  AGGGAGCTGGTTGTGCAAAAGTTTCTGCTTGGTACCCGCTTTAATGAGTATTATCCTCAGTATCGGGTGCATGCTAACCGTTATGTTAATCCGGGGTTGGAGTATGTGGGCAGTGTATGGTGT---GGGAAGCACTTCATTTATGTTAGGGCAGATGGTGCGGAATTTGCT---------------CGCCTTAAGGGCCTGCGAGCCCGATTGGGACAGGGGGTGTTATTTTGTGAATCGTTGTTATCCTGTTATGTGGTAATTGTATGTCAGCAATGTGCTTGTCCCCCCACTGATGCACAAGTGGATCATTGTATGCGTTTGCTAAGTTTTACTCTTCGTAGGTGGCAAAATTTGCTGTTGGGAAGGAGCGGCTCTTCT---------------CCCCTTATTCCAGGTTTTGATATTCCTCGCAACAGAACAGAGAGGTTAAGACAGCGTATGCTGCATCGCTTTTATTCTTACCGCACTCCCATTTATCGC
TRN  10010101100011010
NAM  E434_ADE02/141-286
ASQ  LASWFRMVVDGAMFNQRFIWYREVVNYNMPKEVMFMSSVFMRGRHLIYLRLWYDGHVG-----SVVPAMSFGYS-ALHCGILNNIVVLCCSYCA-DLSEIRVRCCARRTRRLMLRAVRIIAEE-TTA-----------MLYSCRTERRRQQFIRALLQHHRPILM
NAM  E434_ADE09/131-278
ASQ  LAVWFRRVIYGCMFNQRFPWYRQIVNRNMPKEIMYMGSVFMRGRHLIYCRIWYDGHVG-----SIIPNMSFGWS-ALNYGLLNNMVIMCCTYCE-NMAEIRMRCCARRTRRLMLKAVGIIVRE-TCD---------PDPICSSRTEPRRQRLLRALMERHRPILF
DSQ  CTGGCCGTGTGGTTCAGGAGAGTCATTTACGGGTGCATGTTCAACCAGCGCTTCCCCTGGTACCGTCAGATTGTGAACAGAAACATGCCCAAAGAGATCATGTATATGGGCAGTGTGTTTATGAGGGGCAGGCACCTGATATACTGCCGCATCTGGTACGATGGTCACGTGGGT---------------TCCATCATCCCCAACATGAGCTTTGGCTGGAGC---GCCCTGAATTATGGGCTGCTGAATAACATGGTGATTATGTGCTGCACTTACTGTGAG---AACATGGCAGAGATCAGGATGCGGTGCTGTGCCCGACGCACCAGGAGACTGATGCTGAAGGCTGTGGGGATTATAGTCAGAGAG---ACTTGCGAT---------------------------CCCGATCCAATCTGCAGCAGCCGCACCGAGCCCCGGCGGCAGAGACTGCTGAGGGCGCTGATGGAGAGGCACAGACCCATCCTGTTT
TRN  10010101100011011
NAM  E434_ADE12/131-276
ASQ  LGRWFKMAVYGALINKRCFWYREVVNHLMPKEVMYVGSTFVRGRHLIYFKIMYDGHAW-----LALEKVSFGWS-AFNYGILNNMLVLCCDYCK-DLSEIRMRCCARRTRLLMLKVVQVIAEN-TVR-----------PLKHSRHERYRQQLLKGLIMHHRAILF
DSQ  TTGGGACGCTGGTTCAAAATGGCCGTATATGGCGCCTTAATTAACAAAAGGTGTTTTTGGTATCGGGAGGTTGTTAACCATTTAATGCCTAAAGAGGTGATGTATGTGGGAAGCACCTTTGTTAGAGGTCGCCATTTAATTTACTTTAAAATTATGTATGATGGCCATGCCTGG---------------TTAGCGTTAGAAAAAGTTAGTTTTGGATGGAGC---GCCTTTAATTATGGAATTTTAAATAACATGTTAGTGCTGTGTTGTGATTATTGTAAA---GACTTAAGTGAGATACGCATGCGCTGTTGCGCTCGTCGTACCAGACTGCTAATGTTAAAAGTTGTTCAAGTAATTGCTGAAAAC---ACTGTTCGC---------------------------------CCTCTAAAACATAGTCGGCATGAACGTTATCGTCAGCAACTGCTAAAGGGTTTAATTATGCATCATCGAGCAATTTTATTT
TRN  10010101100011010
NAM  E434_ADE40/132-277
ASQ  LANWFKMMIYGSLYNLRFPWYREIVNCGMPKEVLFMGSVFVRGRHFIYIRLLYDGHAA-----IVLERMSFGWS-FFSYGIMNNMVVLGCTYCK-NLDELSVRCCARRTRRLLAKAVKVLGSF-TVR-----------SLMRSLVEPRRQGLLRGLMERYCPFTL
DSQ  TTAGCAAATTGGTTTAAAATGATGATTTATGGTTCACTGTATAACTTAAGATTCCCTTGGTATCGAGAAATTGTAAATTGTGGCATGCCCAAGGAAGTGTTATTTATGGGGAGCGTGTTTGTCAGAGGTAGGCATTTTATATATATTCGCCTGCTGTATGATGGGCACGCGGCT---------------ATAGTGTTGGAGCGCATGTCGTTTGGGTGGAGT---TTTTTTAGTTATGGAATTATGAATAATATGGTGGTGTTGGGCTGTACCTATTGTAAA---AACTTGGATGAGCTTTCTGTGCGGTGCTGCGCTCGTCGGACGCGGCGGCTGCTGGCCAAGGCGGTGAAAGTGTTGGGAAGCTTC---ACCGTTAGG---------------------------------TCACTCATGAGGAGCTTGGTGGAACCCCGGAGACAGGGATTACTGCGGGGCTTGATGGAGCGGTACTGCCCGTTTACGTTG
TRN  10010101100011000
NAM  Q98VN6_9ADEN/104-245
ASQ  LKSIMYEFLRGMSVNQDFLFYREFVNKRLCNRILYQGSVMFRGLHLIYIRVKHWSDLVRV------TELDIQDA-VYCLGYTSWYVVLICRRCA-DEVNEYIHCCARRTRALLRSMADACDLL---------------DIRPSGREVERQRVLRYLLTKHPCICL
DSQ  CTGAAATCAATCATGTATGAATTTTTACGTGGAATGTCTGTGAATCAAGATTTTTTGTTTTACAGAGAATTTGTCAATAAACGATTGTGCAATAGAATTCTGTATCAAGGAAGTGTGATGTTTCGAGGGCTGCATTTAATTTACATCAGGGTCAAGCATTGGTCAGATTTGGTTCGTGTC------------------ACAGAGTTAGACATTCAGGACGCT---GTGTACTGCCTCGGTTACACTAGTTGGTATGTGGTCCTCATTTGCCGACGATGTGCA---GATGAGGTTAATGAATACATACATTGCTGCGCTCGTAGAACTCGCGCACTTCTCCGTAGCATGGCCGATGCGTGTGATTTGTTA---------------------------------------------GACATCAGACCCAGCGGAAGGGAGGTAGAAAGACAACGCGTGTTGAGATACCTTCTCACCAAACATCCGTGTATTTGTTTG
TRN  10010101100011000
NAM  Q98VK6_9ADEN/107-247
ASQ  IVGLFREVLNGTCYNNMFWFYREYVNRGMPERLLYTGSVMFRGIHLIFIRILLDSDSIRI------RKLNCGAC-VFYEGMYCNYLILMCKSCK-HMSEIQARVCARRTRLVLKRASLLCDGC----------------KGGSLKEVWRQRELLRVMKYGKNVSK
DSQ  ATTGTTGGACTGTTTAGGGAGGTTTTGAATGGCACTTGTTACAATAACATGTTTTGGTTCTACAGAGAGTATGTAAACAGAGGAATGCCTGAAAGATTGCTGTACACTGGTAGTGTGATGTTTAGAGGAATTCACTTAATTTTCATCAGGATTTTATTAGATTCAGATAGCATTAGGATA------------------AGAAAGTTAAATTGTGGGGCGTGT---GTTTTCTATGAGGGTATGTATTGCAATTATCTGATTTTGATGTGTAAATCATGTAAA---CACATGTCTGAGATTCAGGCTAGAGTGTGTGCCAGACGCACCCGTTTAGTGTTAAAGAGAGCCTCTCTTTTGTGCGATGGCTGT------------------------------------------------AAAGGTGGAAGTTTGAAAGAGGTTTGGAGGCAGAGGGAGTTGTTGAGGGTGATGAAGTATGGAAAGAATGTGTCTAAA
TRN  10010101100011000
NAM  Q84211_ADEP3/1-157
ASQ  MRSLMREIIRGCEYNRIFWWFREAVNLPSVSRVMYVGSVMFRGAHLMYIKIMYDCDLKLL------RMFHWGEV-IYCDGDYANYIVLVCRRCH-ELSEPVARRCAQRLRHWLKLAAEAIGAQRRGRKQQFTEGEWWSRQRDAEREEERQRALQECMVLGRSVSY
DSQ  ATGCGCTCCCTGATGCGCGAGATCATCCGGGGCTGCGAGTACAATCGCATCTTCTGGTGGTTCAGGGAGGCGGTGAACCTGCCCAGCGTGAGTCGCGTGATGTACGTGGGCAGTGTGATGTTTCGAGGCGCCCACCTGATGTACATAAAGATCATGTATGACTGTGATCTGAAGCTGTTG------------------CGCATGTTCCACTGGGGGGAGGTC---ATCTACTGTGACGGGGACTATGCCAATTACATAGTGCTGGTGTGCCGGCGCTGCCAC---GAGCTGAGCGAGCCGGTGGCTCGGCGCTGCGCCCAGCGCTTGCGGCACTGGCTGAAGCTGGCGGCGGAGGCCATCGGGGCGCAGCGGCGGGGGAGGAAGCAGCAGTTCACGGAGGGGGAGTGGTGGTCCCGGCAGAGGGACGCGGAGCGGGAGGAGGAGAGGCAGAGGGCCCTCCAGGAGTGTATGGTGTTGGGAAGGAGTGTTAGCTAC
TRN  10010101100011011
NAM  E434_ADECT/94-245
ASQ  VQKVIEDFIKGGAMNKKYMWYREFVNSSRPDEINYVGSIIFRNTHYIYFRLSFFRTVHKACMEAIKRCINPELG-VVLKSTYNYWLVLKCKSCS-LQNYCSLKNCAVWVRSVIVRVLKEVEKT-----------PVVLHQTTSKAEERRQSALRQAMMHGRCRQI
DSQ  GTTCAGAAAGTGATTGAGGACTTTATTAAGGGTGGGGCTATGAATAAAAAGTATATGTGGTACCGAGAGTTTGTAAATTCTAGCAGGCCTGATGAAATTAACTATGTGGGGAGTATTATATTTAGAAACACTCACTACATTTATTTTAGACTGTCTTTTTTTAGAACTGTCCATAAAGCCTGCATGGAGGCCATTAAAAGGTGCATTAACCCTGAGCTAGGG---GTAGTTCTTAAAAGCACTTATAATTACTGGCTGGTGCTTAAGTGTAAATCTTGTAGC---CTTCAAAACTATTGTTCTCTTAAAAACTGTGCTGTGTGGGTGAGATCTGTAATAGTGCGGGTGCTGAAAGAGGTTGAAAAGACA---------------------------------CCTGTAGTGCTTCACCAAACCACTTCCAAGGCAGAGGAAAGAAGACAATCTGCTTTGAGACAAGCTATGATGCATGGACGCTGCCGACAGATT
TRN  10010101100011011
NAM  E434_ADECC/100-251
ASQ  LKEFLEEFVMGGFVNKKYLWYREFVNSSRPDEINYVGSIMFRNIHYIYFRLSFFSTVHQACMLAIQRCISPELG-VVFKSTYNYWLVLKCKSCS-LQNYCALKSCAFWVRSIIDRVLREVEKI-----------PVVLHRTTSKAEERRQTALKQAMMYGRCRHI
DSQ  TTAAAAGAATTTCTTGAAGAATTTGTAATGGGTGGGTTTGTGAACAAAAAGTATCTTTGGTACCGAGAGTTTGTGAATTCTAGCAGACCTGATGAGATTAACTATGTGGGGAGTATAATGTTTAGAAACATTCATTACATTTACTTTAGACTGTCTTTTTTTAGCACCGTGCATCAGGCTTGCATGCTTGCCATTCAAAGATGCATTAGCCCCGAGCTAGGG---GTGGTTTTTAAAAGTACTTATAATTACTGGCTGGTGCTTAAGTGTAAATCTTGCAGC---CTCCAAAACTACTGTGCTCTTAAAAGCTGCGCTTTTTGGGTAAGATCTATAATAGATCGGGTGCTGAGAGAGGTTGAAAAGATA---------------------------------CCTGTAGTGCTACATCGGACCACTTCCAAGGCAGAGGAGAGAAGACAAACTGCTTTGAAACAAGCAATGATGTATGGACGGTGTCGACACATT
TRN  10010101100011010
NAM  O71106_ADEB3/68-210
ASQ  FQGLVKQCVHGAQFDRVYWYFRRELSKLSSVFLAYVGSVYVNNVHLIYFNSTFMIEE-----GSYIRCTPWGEC-LWVKGNSCIYLILICRSCN-PLTEMSVNCCLKRCKQKIRYMLNLAPKR---------------VKKHLGLARLRDRFLERLARFREPVLF
DSQ  TTTCAAGGCCTGGTAAAGCAGTGCGTGCACGGTGCGCAGTTTGATAGAGTGTATTGGTATTTCAGGCGGGAGCTGTCAAAGTTGTCCTCTGTTTTTTTGGCCTATGTGGGAAGCGTGTATGTGAATAATGTTCATTTAATTTACTTTAATAGCACTTTCATGATTGAGGAG---------------GGCAGCTACATCAGGTGCACCCCGTGGGGGGAGTGT---TTGTGGGTAAAGGGCAATAGTTGTATATACTTAATTCTCATATGCCGCAGTTGTAAT---CCTTTAACGGAAATGAGTGTAAACTGCTGTCTAAAAAGGTGTAAGCAGAAAATCCGATACATGCTGAACTTGGCCCCGAAGAGA---------------------------------------------GTGAAAAAACATTTAGGACTTGCTCGTCTGCGTGACAGATTCTTGGAGCGGTTAGCCCGTTTTCGAGAGCCTGTGTTGTTT
TRN  10010101100011000
NAM  O71108_ADEB3/101-244
ASQ  LMDLFKMCVAGTAFDTMFPFFRRELSKLSTRYIYYVGSVYVNKVHLLYFTNYVGASNQLL---KSLPTFAWGNV-YMGSGLDDKCIIIPCYDCA-ELSEVSASRCLLKVKEMIMCYLTCLPS---------------DHRYQCGLFEHRDKLIQRVAA-GEPVLK
DSQ  CTGATGGATCTGTTCAAGATGTGTGTTGCGGGCACTGCCTTTGATACCATGTTCCCATTTTTTCGGAGGGAGCTTTCTAAGCTGTCTACTCGGTATATTTACTATGTGGGGAGTGTGTATGTTAACAAGGTGCATTTGCTGTATTTTACCAACTATGTCGGGGCGAGCAATCAGCTCTTA---------AAGTCCCTGCCCACTTTTGCCTGGGGCAATGTG---TACATGGGCAGTGGATTAGATGACAAGTGTATAATCATTCCTTGCTATGACTGTGCT---GAATTAAGTGAAGTGTCTGCTAGTCGATGTTTGCTTAAAGTGAAGGAAATGATTATGTGCTATTTGACATGTTTGCCTAGC---------------------------------------------GACCACCGTTACCAGTGTGGGTTGTTTGAGCACAGGGACAAATTAATTCAACGAGTAGCGGCT---GGAGAGCCAGTGTTGAAA
TRN  10010101100011010
//