EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04489 - DUF570)
FAM  PF04489
PID  DUF570
DES  Protein of unknown function (DUF570)
IPR  IPR007578
ANO  4
ALN  459
AID  0.305407
APH  ((VU10_HHV7J/1-412:0.41976,VU10_HHV6U/8-436:0.31049):0.66213,Q9DWF8_RCMVM/314-728:1.10205,UL31_HCMVA/212-649:0.74036);
ATP  ((VU10_HHV7J/1-412,VU10_HHV6U/8-436),Q9DWF8_RCMVM/314-728,UL31_HCMVA/212-649);
ATL  3.23477
DNO  4
DLN  1377
DID  0.419554
DPH  (VU10_HHV7J/1-412:13.42463,VU10_HHV6U/8-436:9.10697,(Q9DWF8_RCMVM/314-728:22.95659,UL31_HCMVA/212-649:21.80248):15.44360);
DTP  (VU10_HHV7J/1-412,VU10_HHV6U/8-436,(Q9DWF8_RCMVM/314-728,UL31_HCMVA/212-649));
DTL  67.6973
RID  0.305407
RPH  ((VU10_HHV7J/1-412:0.41976,VU10_HHV6U/8-436:0.31049):0.66213,Q9DWF8_RCMVM/314-728:1.10205,UL31_HCMVA/212-649:0.74036);
RTP  ((VU10_HHV7J/1-412,VU10_HHV6U/8-436),Q9DWF8_RCMVM/314-728,UL31_HCMVA/212-649);
RTL  3.23477
LNK  Q9DWF8_RCMVM/314-728:Q9DWF8:AF232689
LNK  UL31_HCMVA/212-649:P16848:X17403
LNK  VU10_HHV6U/8-436:Q01348:X83413
LNK  VU10_HHV7J/1-412:P52524:U43400
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  VU10_HHV7J/1-412
ASQ  MAIA--ESGAFEINVNLGKSI--ASIQKNPIIYM---------RRHLSFYVELLKFIIHQYEQCFLPPKGTILYHNGLIELNTLIIDLNQQITSK-----QQIYSWTSITLPKIFSTKELYFIVASPESENITLNPAVTKGGWLSGSFSFPLS---LSCAYALTGVSSTIYMLPFIPYKFPMTY---------------VDFSTLRTYEVTSEYGSIQIIKQRNFLFLGIIRDLSW-KSQ-----RDNKNFILKAMFVGNWLGIQ--IP-EAFALRLFNNTRFSIQDFEFSINIQNINLTRDN-KILGSLSTVSCDQMPPNLSPENLPNYLVIQFELVSTLANPDHLLFSCNPKLFFTGDILNSAINLQHSPNHYELTVYAPHNLHFYPSCFHIVTLPIQFSSRNDRQ-MLVSSYPNEGYFEVQMCPWVQNSPLQIVIKSFSKNLVLPQGTPIAILLYM
DSQ  ATGGCTATAGCA------GAAAGCGGAGCGTTCGAAATAAATGTCAATCTTGGAAAATCCATC------GCTTCCATACAAAAAAATCCTATAATCTACATG---------------------------CGTAGACATCTCTCTTTTTATGTGGAGTTATTAAAATTTATCATTCATCAATATGAGCAATGTTTTTTACCACCGAAAGGAACGATACTTTACCACAATGGCTTAATCGAACTAAATACTTTAATTATCGATCTGAATCAACAAATTACATCGAAA---------------CAGCAGATCTATAGTTGGACGAGCATTACTTTGCCAAAAATATTTTCGACTAAAGAATTATATTTTATTGTCGCGTCACCAGAGTCGGAAAACATAACTCTCAATCCAGCTGTTACTAAAGGAGGATGGTTATCTGGGAGTTTTAGCTTTCCATTGAGT---------TTAAGTTGTGCATACGCCCTCACTGGCGTATCTTCAACAATCTATATGTTACCATTTATTCCATATAAATTCCCAATGACTTAC---------------------------------------------GTAGACTTTTCGACACTTCGAACATACGAGGTAACAAGTGAATATGGATCAATCCAAATTATAAAACAGCGGAATTTTTTATTTTTGGGAATTATACGGGATCTGTCATGG---AAAAGTCAG---------------AGGGATAACAAGAATTTTATCCTGAAAGCAATGTTCGTTGGAAACTGGTTAGGGATACAA------ATTCCA---GAAGCTTTTGCATTGAGACTTTTTAATAACACACGGTTTTCTATTCAGGATTTTGAATTCTCCATTAACATACAAAATATAAACCTTACTAGGGACAAT---AAAATTTTGGGCTCTCTTTCCACGGTTTCTTGTGATCAGATGCCACCAAACTTGTCTCCAGAGAATCTCCCAAACTATCTAGTTATTCAGTTCGAATTGGTTTCAACTCTCGCAAATCCTGATCATCTACTGTTTTCTTGCAATCCCAAATTGTTTTTCACAGGAGATATTCTGAACAGCGCTATAAATTTACAACATAGTCCTAATCATTATGAGCTTACAGTGTACGCACCACATAATTTACATTTCTATCCCAGCTGTTTTCATATAGTAACATTACCAATTCAGTTTTCATCCAGAAATGATAGACAG---ATGTTGGTGTCAAGCTATCCTAATGAAGGCTACTTTGAAGTACAAATGTGCCCATGGGTACAGAATTCTCCTCTTCAAATTGTTATTAAATCTTTTTCAAAAAATCTAGTGCTACCGCAAGGCACCCCTATTGCAATTCTCTTATATATG
TRN  10010101100011000
NAM  VU10_HHV6U/8-436
ASQ  TVSA--RSPTVTWSSGFGRAI--ASIQKRNQDNI---------RKPLRFYTGLLHCLIKQYEHCLVPPNKSIRFDKGKIEVAALILDLGHQVLGRQIHVRQRIYSWTSITLPKLFTPKELYFLIASPEEENIAFNPTITKGGWISGSFSYPVD---YRSNFSLTGMSANILMVPFVPYKYPLNYARFISS---------IDLMILNEQFPEHECGDIQILKQRNYLYLGVIKNLTW-KKSVTGTGQTAPHRILKASFIGSWPDTS--LP-DRVALRFFNNTRFTIHCHEFSINIENLGLVKNKEKVFGTLATVCCEQIPSLLTTENLPKYLIVQFEVVTQIEEPEPLLFSSNPKLYFTGDVLNATIQLQHNPNYYELLVHAPYDIHFYPSRCHIVILPIRYFTKPDKQ-ILISGYQNEGFFETQVMLWAPGTPLHITLRSFSPNLILPQSTKRRNRKAV
DSQ  ACGGTTTCAGCG------AGATCTCCGACCGTCACCTGGTCATCGGGATTCGGACGAGCTATA------GCTTCGATTCAAAAACGGAATCAAGATAATATC---------------------------AGGAAACCCCTACGCTTCTACACCGGTCTCCTACACTGCCTTATAAAACAATATGAGCATTGCCTCGTCCCGCCAAATAAATCAATACGTTTCGACAAAGGGAAGATTGAAGTCGCTGCCCTAATTCTAGATCTCGGACACCAGGTACTTGGTCGTCAGATACACGTACGACAACGTATCTACAGCTGGACTAGCATCACACTCCCTAAACTCTTTACCCCCAAAGAACTTTACTTTTTAATCGCCTCTCCAGAAGAAGAAAACATCGCATTTAATCCAACTATAACAAAGGGAGGTTGGATCTCGGGGAGTTTTTCGTATCCCGTTGAT---------TACAGATCAAACTTTTCGCTAACCGGAATGTCTGCGAACATATTAATGGTGCCGTTCGTGCCGTACAAATACCCACTAAACTATGCTCGCTTCATATCATCA---------------------------ATCGACCTGATGATACTAAACGAACAATTTCCGGAACACGAATGCGGAGATATACAGATTTTAAAACAGAGAAACTACCTCTACCTGGGAGTCATCAAAAATCTTACGTGG---AAAAAAAGCGTCACCGGCACAGGTCAGACGGCTCCACATAGAATCCTAAAAGCTTCGTTCATAGGAAGTTGGCCGGACACCTCC------CTACCT---GACAGAGTGGCACTGCGTTTCTTTAATAACACTAGGTTTACAATACACTGCCACGAATTCTCGATTAACATTGAAAATCTCGGTCTCGTCAAAAACAAAGAAAAAGTTTTTGGAACACTAGCCACTGTATGCTGCGAGCAAATCCCTTCTTTACTAACAACGGAAAATCTACCGAAATATTTAATAGTTCAGTTTGAAGTGGTAACGCAAATCGAAGAGCCCGAACCGCTGTTATTTTCCAGTAACCCGAAATTATATTTTACAGGAGACGTACTAAACGCAACGATACAACTGCAACACAACCCAAATTATTACGAGCTACTTGTACACGCACCATATGACATCCATTTCTATCCAAGCCGATGCCACATAGTAATTCTACCTATCCGATATTTCACAAAGCCCGACAAGCAA---ATCCTCATATCCGGCTACCAGAACGAAGGATTCTTCGAAACCCAGGTGATGCTGTGGGCCCCGGGAACACCTTTGCACATTACGCTGCGTTCATTTTCTCCAAATCTGATCCTGCCTCAAAGCACAAAAAGACGTAATCGCAAAGCTGTC
TRN  10010101100011000
NAM  UL31_HCMVA/212-649
ASQ  DPEQDYRLPAQDVVTSWIEALRDA--DRDNYGRCVRHAKIHRSASHLTAYESYLVSITEQYNTASNVTEK-ASYVQGCIFLSFPVIYNNTQGCG-------YKYDWSNVVTPKA-AYAELFFLLCSTSESSVVLQPLITKGGLCSSMAVYDEETMRQSQAVQIGFLHTQLVMVPFVPHACPHYAVPFTTPGKPGCGGAPSGVAGLEE---AAPFGRVSVTRHGATL-LCRVDHLTWISKRVTTYGHKKITRYL-AQFRGTMDDDEAALPGEDEAWIASKNVQYEFMGLIFTVNVDSLCVDAEQRQLLGTVATSFCHRVSDKITARNMPR--AFSFYLLTSAQRGYDLRFSRNPSLFFSGDALNCP--LLNEPNVFSLTVHAPYDIHFGVQPRQTVELDLRYVQITDRC-FLVANLPHEDAFYTGLSVWRGGEPLKVTLWTRTRSIVIPQGTPIATLYQI
DSQ  GACCCCGAGCAGGACTATCGTCTGCCGGCGCAGGACGTGGTGACCTCGTGGATCGAAGCGCTACGCGACGCG------GACCGCGACAACTACGGTCGCTGCGTGCGCCACGCCAAGATTCACCGTTCGGCCTCGCACCTGACGGCCTACGAGTCGTACTTGGTGTCCATCACCGAGCAGTACAACACGGCCTCGAACGTGACGGAGAAA---GCTTCGTACGTGCAGGGCTGCATCTTTCTCTCGTTTCCCGTCATTTACAACAACACGCAGGGCTGCGGC---------------------TACAAGTACGACTGGTCCAACGTGGTGACGCCCAAGGCG---GCGTACGCCGAGCTCTTCTTTCTGCTCTGCTCCACCAGCGAGAGCTCCGTGGTGCTGCAACCGCTCATCACCAAGGGCGGGCTCTGCTCGTCCATGGCGGTTTACGACGAGGAAACCATGCGGCAGTCGCAGGCGGTGCAGATCGGTTTTCTGCACACACAACTGGTCATGGTGCCCTTCGTGCCGCACGCCTGCCCGCATTACGCCGTGCCTTTCACGACGCCGGGAAAGCCGGGCTGCGGCGGTGCTCCGAGCGGCGTTGCGGGGTTGGAGGAG---------GCGGCGCCCTTTGGACGGGTCAGCGTCACGCGGCATGGCGCGACGCTG---CTATGTCGCGTGGACCATCTGACCTGGATCAGTAAGCGCGTAACCACGTACGGACACAAAAAAATTACGCGCTACCTC---GCGCAGTTCCGCGGCACGATGGACGACGACGAGGCAGCGCTACCCGGCGAGGACGAAGCGTGGATCGCGTCCAAAAACGTGCAGTACGAATTCATGGGTCTCATTTTCACCGTCAACGTGGATTCACTATGCGTGGACGCGGAACAGCGCCAACTGCTGGGCACCGTGGCCACCTCCTTCTGTCACCGCGTCTCGGACAAGATCACGGCGCGCAACATGCCGCGC------GCTTTTTCCTTCTACCTGCTGACGAGCGCGCAGCGCGGGTACGACCTGCGATTCAGCCGCAACCCGTCACTCTTTTTTAGCGGCGACGCGCTCAACTGTCCG------CTTCTCAATGAGCCCAACGTGTTTTCGCTCACGGTGCACGCGCCTTACGATATCCACTTCGGGGTGCAACCGCGGCAGACGGTGGAGTTGGACTTGCGCTACGTGCAGATCACAGACCGGTGT---TTCTTGGTGGCCAACTTGCCACACGAGGACGCCTTTTACACGGGGCTCAGCGTGTGGCGCGGCGGCGAGCCGCTCAAAGTCACGCTGTGGACGCGCACGCGTTCCATCGTGATCCCGCAGGGCACCCCCATCGCCACGTTGTATCAAATT
TRN  11011101101011001
NAM  Q9DWF8_RCMVM/314-728
ASQ  DTSGECMREICDNLTKYTNSIDFATQDSRFQTNA-------SPRRHINSYRGRLLTIVCQYNQ-LVPDELRARYHKGGIHFSTTVMASPFHLPDGT------LHNWATMLTPRATGIPGGFFLLTSLKGNAAVCQPFITRGGTRAALVTYPSA---SSAPPPKKIVKLDLTCMFFTPFRIPEFGVRMIALDDPMF------------RAGGIAFGIMSPVKRTGATTVALFSGLTW-CIRTAIGEHGQMITTYAAWFECTQDNAY----GTCKFWRPGPPAVYECGEHEVTITVENMYVIHGGRKLIGTLAVRSDYFTAPSLRTEMMPSMLVLRFELYGVRHREPEIMFATNPTCHLAWPL---------GESEHEIHVYSPYDVQFKGGRHHF-SLDLRYFKPQHRRCFLVSVPQDETRFHTAMTVWRPDAPLRLTLVSHLPNLQLHRGTQVATLYLI
DSQ  GACACGTCCGGGGAGTGCATGCGCGAGATCTGCGACAACCTGACGAAGTACACGAACTCGATCGACTTCGCCACGCAGGACTCGCGCTTCCAGACCAACGCG---------------------TCGCCCCGGCGGCACATCAACAGCTACCGCGGGCGGCTGCTGACGATCGTGTGCCAGTACAACCAG---CTGGTGCCCGACGAGCTGCGCGCCCGCTACCACAAGGGCGGGATCCACTTCTCGACGACCGTGATGGCGAGCCCGTTCCACCTGCCGGACGGCACG------------------CTGCACAACTGGGCCACCATGCTGACCCCGCGGGCCACGGGCATCCCGGGCGGCTTCTTCCTGCTGACCTCGCTGAAGGGCAACGCGGCGGTGTGCCAGCCGTTCATCACCCGCGGCGGGACGCGGGCGGCGCTGGTGACCTACCCGTCGGCG---------AGCTCGGCGCCGCCCCCGAAGAAGATCGTGAAGCTGGACCTGACGTGCATGTTCTTCACCCCGTTCCGGATCCCGGAGTTCGGCGTGCGGATGATCGCGCTGGACGACCCCATGTTC------------------------------------CGCGCGGGCGGCATCGCGTTCGGGATCATGAGCCCGGTGAAACGGACCGGGGCGACGACGGTCGCCCTGTTCTCGGGACTGACGTGG---TGCATCCGCACGGCGATCGGCGAACACGGGCAGATGATCACGACGTACGCGGCCTGGTTCGAGTGCACGCAGGACAACGCGTAC------------GGCACCTGCAAGTTCTGGCGCCCCGGGCCGCCGGCGGTGTACGAGTGCGGCGAGCACGAGGTGACCATCACGGTGGAGAACATGTACGTGATCCACGGCGGGAGGAAGCTGATCGGGACGCTGGCCGTGCGCAGCGACTACTTCACCGCGCCGTCGCTACGCACGGAGATGATGCCGAGCATGCTGGTGCTGCGGTTCGAGCTGTACGGCGTGAGGCACCGGGAGCCCGAGATCATGTTCGCCACCAACCCGACGTGCCACCTGGCGTGGCCGCTG---------------------------GGCGAGAGCGAACACGAGATCCACGTGTACTCGCCGTACGACGTGCAGTTCAAGGGCGGACGGCACCACTTC---TCCCTGGACCTGCGGTACTTCAAGCCCCAGCACCGCCGCTGCTTCCTGGTGTCCGTGCCCCAGGACGAGACGCGGTTCCACACGGCCATGACCGTCTGGCGACCGGACGCCCCGCTGCGCCTGACCCTGGTGTCCCACCTCCCGAACCTGCAGCTGCACCGCGGCACCCAGGTGGCCACCCTGTACCTGATC
TRN  10010101100011011
//