EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04421 - Mss4)
FAM  PF04421
PID  Mss4
DES  Mss4 protein
IPR  IPR007515
ANO  5
ALN  116
AID  0.283372
APH  ((MSS4_HUMAN/17-123:0.77182,MSS4_SCHPO/11-100:1.23415):0.22364,MSS4_DROME/32-120:0.22746,(DSS4_YEAST/19-131:1.57963,MSS4_CAEEL/1-86:0.70147):0.30216);
ATP  ((MSS4_HUMAN/17-123,MSS4_SCHPO/11-100),MSS4_DROME/32-120,(DSS4_YEAST/19-131,MSS4_CAEEL/1-86));
ATL  5.04033
DNO  4
DLN  348
DID  0.406373
DPH  (MSS4_SCHPO/11-100:0.78545,(DSS4_YEAST/19-131:1.03164,MSS4_HUMAN/17-123:0.33682):0.18119,MSS4_DROME/32-120:0.25255);
DTP  (MSS4_SCHPO/11-100,(DSS4_YEAST/19-131,MSS4_HUMAN/17-123),MSS4_DROME/32-120);
DTL  2.58765
RID  0.280119
RPH  (MSS4_SCHPO/11-100:1.29628,MSS4_HUMAN/17-123:0.74775,(DSS4_YEAST/19-131:1.83550,MSS4_DROME/32-120:0.28571):0.19289);
RTP  (MSS4_SCHPO/11-100,MSS4_HUMAN/17-123,(DSS4_YEAST/19-131,MSS4_DROME/32-120));
RTL  4.35813
LNK  DSS4_YEAST/19-131:P32601:X70495
LNK  MSS4_CAEEL/1-86:Q9U1X4:
LNK  MSS4_DROME/32-120:Q9VLP3:AE003620
LNK  MSS4_HUMAN/17-123:P47224:S78873
LNK  MSS4_SCHPO/11-100:O43057:AL021730
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  MSS4_SCHPO/11-100
ASQ  CPSVVFNNKRPDVVKRPTMSAMLHS-------------------ETQEDLETDDFFLLKDP-----FAFDNVSVSKPLANNYKLLACADCEKGPLGYYDSKNNEYL--LLCSLEKN
DSQ  TGCCCTTCAGTCGTATTTAATAACAAACGTCCAGATGTTGTTAAGAGGCCAACAATGTCAGCTATGCTGCATTCT---------------------------------------------------------GAAACACAAGAAGATCTAGAAACTGACGATTTTTTTCTTCTAAAAGATCCG---------------TTTGCTTTCGACAACGTTAGCGTATCAAAACCCTTAGCAAATAATTATAAATTACTTGCTTGTGCTGATTGTGAAAAAGGTCCGTTGGGCTACTATGATTCTAAGAACAATGAATATTTA------TTGCTGTGCTCATTGGAGAAAAAC
TRN  10010101100011000
NAM  MSS4_CAEEL/1-86
ASQ  MTTEYLDEER----DLPLPRQKKGI-------------------DHTQTEPIRGFFGVKDM-----FAFENVGFTRSSE-GKRYLVCGECEQGPVGFVDPVTEMNY-VSPERLDVL
NAM  MSS4_HUMAN/17-123
ASQ  NRKAVLCQRCGSRVLQPGTALFSRRQLFLPSMR---KKPALSDGSNPDGDLLQEHWLVEDM-----FIFENVGFTKDVG-NIKFLVCADCEIGPIGWHCLDDKNSFYVALERVSHE
DSQ  AACCGGAAGGCGGTGCTGTGCCAGCGTTGCGGCTCCCGGGTGCTGCAGCCAGGGACCGCTCTCTTCTCTCGCCGACAGCTTTTCCTTCCCTCCATGAGA---------AAGAAGCCAGCTCTGTCTGACGGCAGCAATCCTGACGGCGATCTCCTCCAGGAACACTGGCTGGTTGAGGACATG---------------TTCATTTTTGAGAATGTGGGCTTCACCAAGGACGTGGGC---AACATCAAGTTTCTGGTCTGCGCAGACTGTGAAATTGGACCAATTGGCTGGCATTGCCTAGATGACAAGAACAGTTTCTATGTGGCCTTGGAACGAGTTTCCCATGAG
TRN  10010101100011011
NAM  MSS4_DROME/32-120
ASQ  AQEGTYNQEE---VDVPLMTQKQDR------TA-----------DSLNSEPLKDFWLVKDM-----MTFENIGFSNTVD-GRKFLVCADCERGPVGYHDLSTRHCY-LALKRVVHK
DSQ  GCACAAGAGGGCACCTACAACCAGGAGGAG---------GTGGATGTGCCACTGATGACGCAGAAGCAGGATCGA------------------ACGGCG---------------------------------GACAGCCTAAACAGCGAGCCACTGAAAGACTTCTGGCTGGTCAAGGACATG---------------ATGACATTCGAGAACATCGGGTTCTCCAACACGGTGGAC---GGCAGAAAGTTTCTGGTTTGCGCGGACTGCGAGCGAGGACCTGTGGGCTACCATGATCTGAGCACCCGCCACTGCTAT---CTGGCCCTCAAGAGGGTGGTGCACAAG
TRN  10010101100011011
NAM  DSS4_YEAST/19-131
ASQ  NDDNIINLPEQVHSEFKLLENRTMR-DATPSESNFLVVPDVWDFDNVGVSREIPSSILGDLSDKSDFVFEYGNSSWKIKKCLKYLICADCDKGPIGIICKVQDQTK--NEERVLHL
DSQ  AACGATGATAACATAATAAACTTACCAGAGCAGGTGCACAGCGAATTCAAGTTGCTGGAAAACAGAACTATGCGA---GATGCTACCCCCAGCGAGAGCAACTTCTTGGTCGTCCCTGATGTTTGGGACTTTGATAATGTTGGTGTATCTAGAGAAATTCCTTCTTCTATATTAGGGGATTTGAGTGATAAGAGTGATTTTGTCTTTGAGTATGGTAATTCCAGCTGGAAGATTAAAAAGTGCTTGAAATATTTGATATGCGCTGATTGTGATAAAGGTCCTATTGGAATAATATGTAAGGTGCAAGATCAGACAAAG------AATGAAGAAAGAGTTTTGCATCTA
TRN  10010101100011010
//