EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04413 - Glycos_transf_N)
FAM  PF04413
PID  Glycos_transf_N
DES  3-Deoxy-D-manno-octulosonic-acid transferase (kdotransferase)
IPR  IPR007507
ANO  19
ALN  203
AID  0.320315
APH  (((((((((Q9HUH7_PSEAE/31-221:0.39857,((KDTA_HAEIN/31-223:0.23856,Q9CLD3_PASMU/31-223:0.29561):0.32856,KDTA_ECOLI/31-221:0.24141):0.10988):0.06026,Q9PH41_XYLFA/51-241:0.59076):0.05140,(Q9X773_LEGPN/30-218:0.55293,(O52785_ACIHA/39-232:0.60671,Q9JWS4_NEIMA/31-218:0.38421):0.21905):0.05017):0.13456,((Q983L8_RHILO/38-225:0.45973,Q9ABC8_CAUCR/35-223:0.55929):0.14690,Q9FFN3_ARATH/36-225:0.69333):0.42073):0.11734,Q9KVB3_VIBCH/45-235:0.44736):0.10119,O66663_AQUAE/1-175:1.29592):0.27585,(O25611_HELPY/30-215:0.37615,Q9PPK0_CAMJE/30-205:0.56234):0.45566):0.69832,(P71136_CHLAB/17-210:0.24699,KDTA_CHLPN/39-228:0.33988):0.10452):0.15254,KDTA_CHLMU/35-228:0.16288,KDTA_CHLTR/36-225:0.17152);
ATP  (((((((((Q9HUH7_PSEAE/31-221,((KDTA_HAEIN/31-223,Q9CLD3_PASMU/31-223),KDTA_ECOLI/31-221)),Q9PH41_XYLFA/51-241),(Q9X773_LEGPN/30-218,(O52785_ACIHA/39-232,Q9JWS4_NEIMA/31-218))),((Q983L8_RHILO/38-225,Q9ABC8_CAUCR/35-223),Q9FFN3_ARATH/36-225)),Q9KVB3_VIBCH/45-235),O66663_AQUAE/1-175),(O25611_HELPY/30-215,Q9PPK0_CAMJE/30-205)),(P71136_CHLAB/17-210,KDTA_CHLPN/39-228)),KDTA_CHLMU/35-228,KDTA_CHLTR/36-225);
ATL  12.0282
DNO  19
DLN  609
DID  0.426579
DPH  ((Q9KVB3_VIBCH/45-235:0.41474,(O52785_ACIHA/39-232:0.46258,((O66663_AQUAE/1-175:0.72212,((P71136_CHLAB/17-210:0.18150,(KDTA_CHLPN/39-228:0.30737,(KDTA_CHLTR/36-225:0.17884,KDTA_CHLMU/35-228:0.17317):0.14352):0.09745):0.37655,(O25611_HELPY/30-215:0.43342,Q9PPK0_CAMJE/30-205:0.31988):0.17061):0.17307):0.07980,Q9X773_LEGPN/30-218:0.31427):0.12316):0.08116):0.12281,(Q9JWS4_NEIMA/31-218:0.44974,(Q9PH41_XYLFA/51-241:0.41979,((Q9FFN3_ARATH/36-225:0.61891,(Q983L8_RHILO/38-225:0.21106,Q9ABC8_CAUCR/35-223:0.40556):0.17361):0.18703,Q9HUH7_PSEAE/31-221:0.25338):0.15517):0.02719):0.15857,((KDTA_HAEIN/31-223:0.23453,Q9CLD3_PASMU/31-223:0.30696):0.20334,KDTA_ECOLI/31-221:0.26229):0.08209);
DTP  ((Q9KVB3_VIBCH/45-235,(O52785_ACIHA/39-232,((O66663_AQUAE/1-175,((P71136_CHLAB/17-210,(KDTA_CHLPN/39-228,(KDTA_CHLTR/36-225,KDTA_CHLMU/35-228))),(O25611_HELPY/30-215,Q9PPK0_CAMJE/30-205))),Q9X773_LEGPN/30-218))),(Q9JWS4_NEIMA/31-218,(Q9PH41_XYLFA/51-241,((Q9FFN3_ARATH/36-225,(Q983L8_RHILO/38-225,Q9ABC8_CAUCR/35-223)),Q9HUH7_PSEAE/31-221))),((KDTA_HAEIN/31-223,Q9CLD3_PASMU/31-223),KDTA_ECOLI/31-221));
DTL  8.99403
RID  0.320315
RPH  (((((((((Q9HUH7_PSEAE/31-221:0.39857,((KDTA_HAEIN/31-223:0.23856,Q9CLD3_PASMU/31-223:0.29561):0.32856,KDTA_ECOLI/31-221:0.24141):0.10988):0.06026,Q9PH41_XYLFA/51-241:0.59076):0.05140,(Q9X773_LEGPN/30-218:0.55293,(O52785_ACIHA/39-232:0.60671,Q9JWS4_NEIMA/31-218:0.38421):0.21905):0.05017):0.13456,((Q983L8_RHILO/38-225:0.45973,Q9ABC8_CAUCR/35-223:0.55929):0.14690,Q9FFN3_ARATH/36-225:0.69333):0.42073):0.11734,Q9KVB3_VIBCH/45-235:0.44736):0.10119,O66663_AQUAE/1-175:1.29592):0.27585,(O25611_HELPY/30-215:0.37615,Q9PPK0_CAMJE/30-205:0.56234):0.45566):0.69832,(P71136_CHLAB/17-210:0.24699,KDTA_CHLPN/39-228:0.33988):0.10452):0.15254,KDTA_CHLMU/35-228:0.16288,KDTA_CHLTR/36-225:0.17152);
RTP  (((((((((Q9HUH7_PSEAE/31-221,((KDTA_HAEIN/31-223,Q9CLD3_PASMU/31-223),KDTA_ECOLI/31-221)),Q9PH41_XYLFA/51-241),(Q9X773_LEGPN/30-218,(O52785_ACIHA/39-232,Q9JWS4_NEIMA/31-218))),((Q983L8_RHILO/38-225,Q9ABC8_CAUCR/35-223),Q9FFN3_ARATH/36-225)),Q9KVB3_VIBCH/45-235),O66663_AQUAE/1-175),(O25611_HELPY/30-215,Q9PPK0_CAMJE/30-205)),(P71136_CHLAB/17-210,KDTA_CHLPN/39-228)),KDTA_CHLMU/35-228,KDTA_CHLTR/36-225);
RTL  12.0282
LNK  KDTA_CHLMU/35-228:Q9PKI5:AE002316
LNK  KDTA_CHLPN/39-228:Q46222:Z31593
LNK  KDTA_CHLTR/36-225:Q57440:Z22652
LNK  KDTA_ECOLI/31-221:P23282:M60670
LNK  KDTA_HAEIN/31-223:P44806:AJ277814
LNK  O25611_HELPY/30-215:O25611:AE000604
LNK  O52785_ACIHA/39-232:O52785:Z96927
LNK  O66663_AQUAE/1-175:O66663:AE000684
LNK  P71136_CHLAB/17-210:P71136:U72500
LNK  Q983L8_RHILO/38-225:Q983L8:BA000012
LNK  Q9ABC8_CAUCR/35-223:Q9ABC8:AE005704
LNK  Q9CLD3_PASMU/31-223:Q9CLD3:AE006169
LNK  Q9FFN3_ARATH/36-225:Q9FFN3:AB005235
LNK  Q9HUH7_PSEAE/31-221:Q9HUH7:AE004911
LNK  Q9JWS4_NEIMA/31-218:Q9JWS4:AL162752
LNK  Q9KVB3_VIBCH/45-235:Q9KVB3:AE004112
LNK  Q9PH41_XYLFA/51-241:Q9PH41:AE003864
LNK  Q9PPK0_CAMJE/30-205:Q9PPK0:AL139076
LNK  Q9X773_LEGPN/30-218:Q9X773:AJ011775
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.....xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...............xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx......xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9X773_LEGPN/30-218
ASQ  YRQRIGERFC-LGIQENAP--VDVWLHAVSLGEVIAATPLIDAMLN--KHWSVLVTTMTPTGSERVKSRFG.....HK--VAHQYLPYDLHRVLRRFYKRTEPRVGIIMETELWPNLIKQAHASGVALFLANGRLSDRSLQGYL..KLKFLFKPVLNQFSRILTQSNEDAERFIALGANADLVHVLGNMKFDLQIDSVDSSQY
DSQ  TACAGGCAAAGGATAGGAGAGCGTTTTTGT---CTGGGAATACAAGAAAATGCACCA------GTTGATGTATGGCTTCATGCGGTTTCTCTGGGAGAAGTGATCGCGGCAACACCTTTAATTGATGCAATGCTCAAC------AAACATTGGTCAGTGTTAGTTACCACAATGACCCCTACAGGTTCTGAACGAGTAAAATCTCGATTTGGT...............CATAAA------GTAGCGCATCAATATTTACCCTATGATTTACATAGGGTTCTCAGACGATTTTATAAAAGAACGGAACCTCGTGTCGGGATCATTATGGAGACTGAATTGTGGCCTAATTTAATTAAGCAGGCTCATGCTTCAGGAGTGGCATTATTTCTGGCGAATGGACGCTTATCTGATCGCTCCTTGCAAGGATATCTA......AAGCTTAAATTTTTATTTAAACCGGTTTTGAATCAATTTTCCCGAATTTTGACTCAAAGCAATGAGGATGCTGAGAGATTCATTGCCTTGGGTGCAAATGCCGATTTAGTCCATGTATTAGGGAATATGAAGTTTGATTTGCAGATTGACTCTGTTGATAGTAGTCAATAC
TRN  10010101100011000
NAM  Q9HUH7_PSEAE/31-221
ASQ  YAKRIGERFS-LSLPEVPP--GGIWVHAVSVGESIAAAPMVRALLERHPQLPVTVTCMTPTGSERIRALFG.....EQ--VRHCYLPYDLPWAAARFLDRVRPRLAVIMETELWPNHIHACAVRGIPVALANARLSERSARGYA..RFAGLTRPMLAELSWIAVQTEAEAERFRRLGARPECVSVTGSIKFDLRIDPQLPLAA
DSQ  TATGCCAAGCGCATCGGCGAGCGTTTTTCC---CTGTCCTTGCCCGAGGTGCCGCCC------GGCGGCATCTGGGTGCACGCCGTCTCGGTGGGCGAGAGCATCGCCGCCGCGCCGATGGTGCGGGCGCTGCTGGAGCGCCATCCGCAGCTGCCGGTCACCGTCACCTGCATGACCCCGACCGGCTCGGAGCGCATCCGCGCATTGTTCGGC...............GAGCAG------GTCCGGCACTGCTACCTGCCCTACGACCTGCCCTGGGCGGCGGCGCGCTTCCTCGACCGGGTGCGGCCGCGCCTGGCGGTGATCATGGAAACCGAGCTGTGGCCCAACCATATCCATGCCTGCGCCGTGCGCGGGATCCCGGTGGCGCTGGCCAATGCGCGCCTGTCCGAGCGCTCGGCGCGTGGCTACGCG......CGCTTCGCCGGGCTGACCCGGCCGATGCTCGCCGAGCTGTCCTGGATCGCCGTGCAGACCGAGGCCGAGGCCGAGCGCTTCCGTCGTCTCGGCGCGCGTCCTGAGTGCGTCAGCGTGACCGGCTCGATCAAGTTCGACCTGCGCATCGACCCGCAGCTGCCGCTGGCCGCT
TRN  11011111101111111
NAM  KDTA_ECOLI/31-221
ASQ  YRKRWGERYG-FYRHPLKP--GGIMLHSVSVGETLAAIPLVRALRHRYPDLPITVTTMTPTGSERVQSAFG.....KD--VQHVYLPYDLPDALNRFLNKVDPKLVLIMETELWPNLIAALHKRKIPLVIANARLSARSAAGYA..KLGKFVRRLLRRITLIAAQNEEDGARFVALGAKNNQVTVTGSLKFDISVTPQLAAKA
DSQ  TATCGAAAACGCTGGGGTGAACGTTACGGT---TTTTACCGCCATCCGCTAAAACCA------GGCGGCATTATGCTGCACTCCGTCTCCGTCGGTGAAACTCTGGCGGCAATCCCGTTGGTGCGCGCGCTGCGTCATCGTTATCCTGATTTACCGATTACCGTAACAACCATGACGCCAACCGGTTCGGAGCGCGTACAATCGGCTTTCGGG...............AAGGAT------GTTCAGCACGTTTATCTGCCGTATGATCTGCCCGATGCACTCAACCGTTTCCTGAATAAAGTCGACCCTAAACTGGTGTTGATTATGGAAACCGAACTATGGCCTAACCTGATTGCGGCGCTACATAAACGTAAAATTCCGCTGGTGATCGCTAACGCGCGACTCTCTGCCCGCTCGGCCGCAGGTTATGCC......AAACTGGGTAAATTCGTCCGTCGCTTGCTGCGTCGTATTACGCTGATTGCTGCGCAAAATGAAGAAGATGGTGCACGTTTTGTGGCGCTGGGCGCAAAAAATAATCAGGTGACCGTTACCGGTAGCCTGAAATTCGATATTTCTGTAACGCCGCAGTTGGCTGCTAAAGCC
TRN  11011101101011010
NAM  Q9CLD3_PASMU/31-223
ASQ  YRKRLNERYG-FYCGAVPPKANGVVIHAASVGEVIAATPLIKRLQALYPTLPLTVTTVTPTGSDRVKAAFG.....DS--VTHFYLPYDLPDAVNRFIAFVQPKVCIVIETEIWPNLIVQLKKQAIPFIIANARLSARSTQRYH..WFKGALHHIFDHISLIASQDNVSAQRYLSLGYDAQRLKLTGNIKYDLVLNDALMQQV
DSQ  TACCGTAAACGCCTTAATGAACGTTATGGC---TTTTATTGTGGTGCAGTGCCACCAAAAGCAAATGGTGTTGTCATCCATGCGGCCTCTGTGGGCGAGGTTATTGCGGCAACGCCACTGATTAAGCGTCTGCAAGCCCTTTATCCGACGTTACCCCTGACAGTCACCACGGTGACCCCCACCGGCTCTGATCGAGTGAAGGCCGCCTTTGGC...............GACAGT------GTTACTCACTTTTACTTACCTTACGATTTACCGGATGCCGTTAACCGTTTTATTGCCTTTGTGCAACCGAAAGTCTGTATTGTGATTGAAACTGAAATTTGGCCCAATTTAATTGTGCAACTCAAAAAACAAGCCATTCCGTTTATTATTGCTAATGCGCGTTTATCCGCACGTTCAACACAGCGTTATCAC......TGGTTCAAAGGCGCACTACATCACATTTTTGATCACATCAGTCTAATTGCATCACAAGATAACGTCAGTGCTCAACGTTATTTATCGCTCGGTTATGATGCGCAACGTTTAAAATTAACTGGCAACATCAAATATGATTTAGTACTCAACGATGCGCTGATGCAACAAGTT
TRN  11011101101011000
NAM  KDTA_HAEIN/31-223
ASQ  YRQRLAERYG-FYGNASCPPPQGIFIHAASVGEVIAATPLVRQLQQDYPHLSITFTTFTPTGSERVKATFG.....DS--VFHYYLPLDLPFSIHRFINFVQPKLCIVMETELWPNLIHQLFLRNIPFVIANARLSARSAHRYG..KIKAHLQTMWSQISLIAAQDNISGKRYATLGYPKEKLNITGNIKYDLNTNDELLRKI
DSQ  TATCGTCAGCGTTTGGCTGAACGTTATGGT---TTTTATGGCAATGCGTCTTGCCCACCACCACAAGGGATCTTTATCCACGCAGCCTCCGTAGGGGAAGTGATTGCTGCGACACCGCTGGTTCGTCAATTGCAACAAGATTATCCACATTTATCCATTACTTTTACGACTTTTACGCCCACAGGTTCAGAGCGCGTCAAAGCCACTTTTGGA...............GATAGT------GTTTTTCATTATTATCTCCCCCTTGATTTACCTTTTTCGATCCATCGTTTTATTAATTTTGTACAACCTAAATTATGTATCGTGATGGAAACAGAACTTTGGCCTAATCTTATTCATCAATTATTTTTACGCAATATTCCATTTGTTATCGCTAATGCACGTTTATCTGCGCGTTCTGCGCATCGTTACGGA......AAAATAAAAGCGCACTTACAAACAATGTGGTCACAAATTAGCTTGATTGCAGCGCAGGATAACATTAGTGGAAAACGCTATGCCACTTTGGGCTATCCAAAGGAAAAATTGAATATCACGGGCAATATTAAATATGATCTCAATACGAATGATGAACTATTACGTAAAATT
TRN  10010101100011000
NAM  Q9PH41_XYLFA/51-241
ASQ  YFNRWNERYA-SYPAAYAR--PQVWLHAVSVGEVNAAASLVNALRQQRPDIRWVITTITPTGSERVRALWG.....DS--LEHVYLPYDVPGSVERFLRYFRPQLALILETELWPNLLFGCRSHGIPVYILNARLSVRSLRGYR..LLKPLIRRALRSVVCVAAQSQEDALRFLRLGARPDQVVALGNLKFDIPTPQDLDVFM
DSQ  TATTTCAACCGATGGAATGAACGCTATGCT---TCGTATCCAGCAGCGTATGCTCGT------CCTCAGGTGTGGTTACATGCTGTTTCGGTCGGTGAGGTCAATGCTGCTGCCTCGTTGGTGAATGCGTTGCGCCAACAACGGCCGGATATCCGTTGGGTCATCACCACCATTACCCCCACAGGATCTGAGCGGGTGCGTGCGCTCTGGGGG...............GATTCA------TTGGAGCATGTGTATTTGCCATACGATGTGCCCGGCAGTGTGGAACGTTTTCTGCGCTATTTTCGTCCACAATTAGCGCTGATTTTGGAAACGGAGCTGTGGCCGAATTTGCTGTTCGGTTGCCGCAGTCATGGCATTCCTGTGTATATCCTCAATGCACGGCTGTCGGTACGTTCGTTGCGTGGTTATCGT......TTGCTCAAGCCGCTCATCAGGCGTGCGTTACGTTCTGTGGTGTGTGTGGCGGCGCAATCGCAAGAGGATGCACTGCGCTTTTTGCGTCTGGGTGCGCGTCCCGATCAAGTGGTTGCATTAGGTAATTTGAAGTTCGATATCCCCACACCACAGGATCTTGATGTTTTCATG
TRN  10010101100011000
NAM  Q9KVB3_VIBCH/45-235
ASQ  VGKRWKEHFGI--TPPLKTTTPPIWIHAASVGETLAVTPLIKQIKQRSPNTPILLTTTTPTGAEQAEKLAD.....---WVEHRYTPIDFSFAVRGFLRRVRPCQLIIVETELWPNTLHTVAKAGLPITLVNARLSEKSYRGYQ..RIHPFFNSMAKPLSLVLCQFADDAQRFIQLGVAETKIKITGSIKFDINITYEVIAQG
DSQ  GTCGGAAAACGTTGGAAAGAGCATTTCGGCATT------ACCCCACCACTAAAAACCACAACCCCACCGATCTGGATCCATGCCGCGTCGGTGGGTGAAACCCTAGCGGTAACGCCACTCATAAAACAAATTAAGCAACGTTCACCGAATACACCAATTCTGCTGACTACCACGACCCCGACGGGTGCTGAACAAGCGGAAAAATTGGCGGAT...............---------TGGGTTGAGCATCGTTATACCCCGATTGATTTTTCCTTTGCGGTGAGAGGCTTTTTGCGTCGTGTACGACCTTGCCAATTGATCATAGTGGAAACAGAACTGTGGCCAAATACTCTGCATACCGTTGCCAAAGCGGGTTTGCCGATTACACTCGTGAATGCACGACTTTCGGAAAAATCCTATCGCGGCTATCAG......CGTATTCACCCGTTCTTTAACAGTATGGCGAAACCTCTCAGCCTAGTGTTATGTCAATTTGCAGACGATGCGCAGCGTTTTATTCAGCTCGGTGTGGCTGAGACAAAAATCAAAATTACCGGTTCGATTAAGTTTGATATCAACATCACCTATGAGGTGATTGCTCAAGGT
TRN  10010101100011000
NAM  Q9JWS4_NEIMA/31-218
ASQ  YRAHRGERFGKPYPNPVTG---AVWIHAVSVGETRAAQPLIRELRQRFPDAPLLMTQMTPTGRETAQVLFP.....D---AQCRYLPYDKKTWVRQFLREHRPMFGILMETEIWPNLMKECRRTGVPLFLANARLSEKSLNGYL..KVRSLIRPAAASLTGCLAQTEADAARLAKLGAAS--VQVCGNTKYDLMPSEQMKTLA
DSQ  TATCGGGCGCATCGGGGCGAGCGTTTCGGCAAGCCGTATCCGAATCCCGTTACCGGC---------GCGGTTTGGATACACGCCGTTTCGGTCGGGGAAACGCGTGCCGCCCAACCTTTGATACGCGAGTTGCGGCAGCGTTTTCCCGATGCGCCGCTGCTGATGACGCAGATGACCCCGACGGGACGGGAAACCGCGCAAGTTCTGTTTCCT...............GAT---------GCACAATGCCGCTATCTTCCGTATGACAAAAAAACGTGGGTACGGCAGTTTTTGCGCGAACACCGCCCGATGTTCGGCATTTTGATGGAAACCGAAATCTGGCCCAATCTGATGAAGGAATGCCGGCGCACGGGTGTGCCGCTGTTTTTGGCGAATGCGCGGCTGTCGGAAAAATCGCTAAACGGTTATCTG......AAAGTCCGCAGCCTGATCCGTCCTGCCGCCGCTTCGCTGACGGGCTGTCTGGCACAGACGGAGGCGGATGCGGCGCGGTTGGCGAAATTGGGCGCGGCATCC------GTGCAGGTGTGCGGCAATACCAAATACGACCTGATGCCGTCGGAACAGATGAAAACGCTGGCG
TRN  10010101100011011
NAM  O52785_ACIHA/39-232
ASQ  YQQECVERFG-PFQPPKNL--ATIWFHVVSVGETNAAQPLIEHYLK--LGHPVLVTNTTKTGQARAKSLFLkapylDL--FQAVYLPVDQKSLLKQFFELYQPKFLALVETEIWPNLIAEARQQQIPCILLNARLSEKSAKGYG..KVSRLTRPMLQQLTWLLAQDKATQQRYIELGLDRTKSQVVGNIKFDITAPQQFVEQA
DSQ  TATCAGCAAGAATGTGTGGAGCGGTTTGGT---CCCTTCCAGCCACCAAAAAATTTA------GCGACCATTTGGTTTCATGTGGTTTCTGTCGGTGAAACCAATGCTGCACAGCCTTTGATTGAGCATTATTTAAAA------TTAGGTCATCCAGTACTGGTCACCAATACCACCAAGACAGGTCAAGCTCGAGCAAAATCACTTTTTTTAaaagcgccttatcttGATTTA------TTTCAGGCGGTTTACTTACCCGTTGATCAAAAGTCATTACTCAAACAGTTTTTTGAGTTATATCAACCAAAATTCTTGGCTTTGGTTGAAACTGAAATTTGGCCGAACTTAATTGCTGAAGCAAGACAACAACAAATTCCCTGTATTTTGCTCAATGCACGCCTTTCGGAAAAATCAGCCAAAGGCTATGGA......AAAGTGAGTCGTTTAACTCGACCGATGTTACAACAGCTGACTTGGCTGTTGGCACAAGATAAAGCTACCCAACAACGCTATATTGAGTTAGGTCTGGATCGAACAAAAAGTCAGGTCGTAGGAAATATAAAATTTGATATTACTGCTCCCCAGCAGTTTGTCGAGCAAGCA
TRN  10010101100011000
NAM  Q9FFN3_ARATH/36-225
ASQ  HFSRWPERFG-HPSAVRPPG-SLIWFHAVSLGEGMAAIPVIRHCNEVKSDLTILMTTTTVSAFEVIKNQLP.....VG--VLHQFAPLDTPLAIDRFLGHWKPNAIIIMENELWPNLIMAASGLLIPLGLLNARMSTKSFKRWSspLLLPLVSLLLSKFSLIA----PLGIRFQLLHAPPFVINYSGDLKYVVNKFHVSSGTS
DSQ  CATTTCAGCCGTTGGCCCGAGCGGTTCGGT---CATCCCTCCGCCGTAAGACCACCGGGA---TCGCTTATCTGGTTTCACGCCGTCTCTTTAGGTGAAGGAATGGCTGCTATTCCGGTGATCAGACACTGCAATGAAGTAAAGTCAGATTTGACTATCCTAATGACGACGACGACAGTATCTGCATTTGAAGTAATAAAGAATCAGCTCCCT...............GTTGGT------GTATTACATCAGTTTGCACCACTGGATACACCTTTAGCTATTGACAGATTCCTTGGCCATTGGAAACCGAATGCGATTATCATAATGGAGAACGAACTCTGGCCTAATCTTATCATGGCTGCTTCAGGACTTCTAATTCCGTTGGGATTGTTGAACGCTCGGATGTCTACTAAATCCTTTAAACGGTGGTCGagtccgCTCTTACTACCGCTGGTATCGTTGTTGCTATCTAAATTCTCATTGATAGCC------------CCACTGGGTATACGTTTTCAGTTGCTGCATGCGCCACCCTTTGTCATAAATTATTCTGGTGACTTAAAATACGTGGTAAACAAGTTCCATGTATCTAGTGGAACATCT
TRN  10010101100011000
NAM  Q9ABC8_CAUCR/35-223
ASQ  DPARLAERLA-RADTPRPEG-PLVWLHGASVGESLSILPLVERLRAEKPEVTVLVTSGTTTSAALLAKRLP.....PG--AIHQYAPVDAPGAARRFIAQWKPDLAVFVESELWPNLLLEAKAAGTRLALVSAKLSDRSFASWS..TRPQAAYRLLSVFDLILAQDARAHQRFERLGGK---VAGEADLKFGATPLPVDAAAL
DSQ  GATCCCGCCCGTCTGGCCGAACGTCTGGCC---CGGGCCGATACGCCGCGCCCTGAGGGC---CCGCTGGTCTGGCTGCACGGCGCCAGCGTCGGCGAGAGCCTATCGATCCTGCCGCTGGTCGAACGTCTGCGCGCTGAGAAGCCCGAAGTCACCGTGCTGGTGACCTCGGGGACCACCACCTCGGCCGCCCTGCTGGCCAAGCGCCTGCCG...............CCGGGC------GCGATCCACCAGTACGCGCCCGTCGACGCACCGGGGGCCGCCCGGCGGTTCATCGCGCAGTGGAAGCCCGACCTCGCCGTGTTCGTCGAGAGCGAGCTGTGGCCGAACCTCCTCCTGGAGGCGAAAGCCGCCGGGACGCGGCTGGCCCTCGTCTCGGCCAAGCTCTCGGACCGCAGCTTCGCTAGCTGGTCC......ACGCGTCCGCAGGCCGCGTATCGACTGCTTTCGGTGTTCGACCTAATCCTGGCCCAGGACGCCCGCGCCCATCAGCGCTTCGAGCGTCTGGGCGGCAAG---------GTCGCGGGCGAGGCCGATCTAAAGTTCGGCGCGACGCCCCTGCCGGTCGATGCGGCGGCCCTG
TRN  11011101101011011
NAM  Q983L8_RHILO/38-225
ASQ  DRHRRRERYG-VAGRPRPEG-PVIWIHAASVGETIAVVPLVESILD--YGVNIVLTTGTVTSAQVADERLG.....DR--IIHQYVPLDLKPAVSRFLDHWQPDLAIIAESEIWPMTILELGARHVPQVLVNGRLSDRSFTSWK..KRANIAEALFENLAHVVAQSDVDGERFRTLGARP--VTVSGNLKVDTNPPPVDERVL
DSQ  GACCGCCACCGTCGCCGCGAGCGCTACGGC---GTCGCCGGTCGCCCGCGCCCCGAAGGG---CCTGTGATCTGGATCCATGCCGCCAGTGTTGGCGAGACCATAGCCGTCGTGCCGCTGGTCGAGAGCATTCTCGAT------TATGGCGTCAACATCGTGCTGACCACCGGTACGGTGACATCGGCCCAGGTCGCCGACGAGCGGCTCGGC...............GACCGC------ATCATCCACCAATATGTGCCACTCGACCTGAAACCGGCGGTCAGCCGGTTCCTCGATCACTGGCAGCCGGACCTGGCGATCATCGCCGAATCCGAAATCTGGCCGATGACCATCCTCGAGCTTGGCGCGCGCCACGTGCCGCAGGTGCTGGTCAATGGCAGGCTGTCCGACCGCTCTTTCACCTCATGGAAG......AAGCGCGCCAACATCGCCGAGGCGCTGTTCGAGAACCTCGCCCATGTCGTTGCCCAGTCCGATGTCGACGGCGAGCGTTTTCGCACGCTGGGCGCCCGGCCG------GTCACCGTCTCGGGCAACCTCAAGGTCGACACCAATCCGCCGCCGGTCGACGAACGGGTATTG
TRN  10010101100011001
NAM  Q9PPK0_CAMJE/30-205
ASQ  YKISLKSRFF-LYKNLHQEK-ADVHFHACSYGEVRSIKALV-------LKFDSRITTITQTGFECAKEFCK.....-----KVNYLAFENFLPFW---LKPCKVLVIF-EAEYWLMLVFMARIYKAKIILLNARISDKSYHSYQ..RFSFFYKKIFSYIDEVFAQSDLDKARLESLGAKN--VKIFKNIKANLEIKNNKIYTK
DSQ  TACAAAATTAGTTTAAAATCTCGATTTTTT---CTTTATAAAAATTTACATCAAGAAAAA---GCTGATGTACATTTTCATGCTTGTTCTTACGGGGAGGTAAGAAGTATTAAAGCTTTGGTT---------------------TTGAAATTTGATTCAAGAATAACTACTATTACTCAAACAGGTTTTGAATGTGCAAAAGAATTTTGTAAA...............---------------AAGGTAAATTATCTTGCTTTTGAAAATTTTTTGCCTTTTTGG---------CTTAAGCCTTGTAAGGTTTTGGTAATTTTT---GAAGCAGAATATTGGCTTATGCTTGTTTTTATGGCACGTATTTATAAGGCTAAGATTATTTTGCTTAATGCGAGAATATCTGATAAGTCTTATCATTCTTATCAA......AGATTTTCTTTTTTTTATAAAAAAATTTTTTCTTATATTGATGAAGTTTTTGCTCAAAGTGATTTAGATAAAGCAAGACTTGAAAGTTTGGGAGCTAAAAAT------GTTAAAATTTTTAAAAATATTAAGGCAAATTTAGAAATTAAAAATAATAAAATTTATACCAAA
TRN  10010101110011000
NAM  O25611_HELPY/30-215
ASQ  YRHSLKARFF-LKDNFLKSE-PVFWFHACSYGEVKSLEPIIHALKE-----PILISVTTNTGFELAAQTYQ.....HSKHIEVRYLPFETLLFAWKKNLKRLKTLVVT-EAELWFNVFDTAQKLGAKTMLINARISVRSYPKYQ..RFSFFYALLFKRIDLILAQSKEDKKRLLNLGAKK--VVDFLNIKRFSKPVITSFYPK
DSQ  TACCGCCATTCTTTGAAAGCCCGTTTTTTT---CTCAAAGACAATTTTTTAAAAAGCGAG---CCGGTTTTTTGGTTCCATGCATGCTCTTATGGGGAGGTCAAATCCTTAGAGCCAATCATTCACGCTTTAAAAGAG---------------CCGATTTTAATCAGCGTTACCACTAATACCGGCTTTGAATTAGCCGCTCAAACTTATCAG...............CATTCTAAGCATATAGAAGTGCGTTACCTGCCTTTTGAAACCCTATTATTTGCATGGAAAAAAAACTTAAAACGCTTAAAAACTTTGGTGGTTACA---GAAGCGGAATTGTGGTTTAATGTGTTTGATACGGCTCAAAAATTAGGGGCAAAAACCATGCTCATTAACGCTCGAATCAGCGTTCGTTCTTACCCCAAGTATCAG......CGTTTTTCTTTCTTTTATGCGCTTTTATTCAAACGCATTGATTTGATTTTAGCGCAAAGCAAGGAGGATAAAAAGCGTTTGTTGAATCTAGGGGCAAAAAAA------GTGGTGGATTTTTTGAATATCAAGCGTTTTTCAAAGCCTGTGATCACTTCGTTTTACCCTAAA
TRN  10010101100011000
NAM  P71136_CHLAB/17-210
ASQ  YTKSLGIRFG-FKKPEVPGTGPVAWFHGASVGETALLLPLLKQFMKDYPEWRCVVTSCTESGHENAHRLFG.....PLG-VTTFILPLDLSIIIKPVVRAIAPSLVVFSEGDCWLNFIEEAKRLGATAIIINGKLSANSCKRFT..ILKRFGRNYFSPIDGFLLQDEQHKARFLQLGVDKEKIEVTGNIKTYTETISENSQRD
DSQ  TATACCAAGTCATTAGGTATTCGTTTTGGT---TTTAAGAAACCAGAAGTGCCAGGAACGGGACCCGTAGCTTGGTTTCATGGAGCTTCTGTAGGTGAGACAGCTCTCCTTCTTCCCTTATTAAAACAGTTCATGAAAGATTATCCGGAATGGCGTTGTGTTGTGACTTCTTGTACCGAATCAGGACATGAGAATGCTCACAGGTTGTTTGGA...............CCTCTCGGA---GTAACAACTTTTATTTTACCTTTAGATTTAAGCATAATCATTAAACCTGTTGTTCGAGCTATCGCACCATCTTTAGTAGTTTTTTCTGAGGGAGACTGTTGGCTGAATTTTATTGAAGAGGCCAAAAGGCTCGGTGCTACTGCCATTATTATTAATGGGAAGCTTTCAGCTAATTCTTGTAAACGGTTCACC......ATTTTAAAACGTTTTGGTAGGAACTATTTTTCCCCTATAGACGGCTTTTTACTACAAGATGAGCAGCATAAAGCACGTTTTTTGCAGCTGGGTGTTGATAAAGAGAAAATAGAAGTTACTGGAAATATCAAGACGTATACAGAAACCATATCTGAAAATAGCCAGCGAGAT
TRN  10010101100011000
NAM  KDTA_CHLPN/39-228
ASQ  YKKSLAVRFG-LKKPHVPGEGPLVWFHGASVGEVRLLLPVLEKFCEEFPGWRCLVTSCTELGVQVASQVFI.....PMG-ATVSILPLDFSIIIKSVVAKLRPSLVVFSEGDCWLNFIEEAKRIGATTLVINGRISIDSSKRFK..FLKRLGKNYFSPVDGFLLQDEVQKQRFLSLGIP----EHKLQVTGNIKTYVAAQTAL
DSQ  TATAAGAAATCTCTAGCAGTTCGTTTTGGT---CTGAAAAAGCCGCATGTCCCTGGAGAAGGGCCTTTGGTGTGGTTTCATGGAGCATCTGTAGGGGAAGTTCGTTTGCTTCTACCTGTACTTGAAAAATTTTGTGAAGAATTTCCAGGTTGGCGTTGTCTAGTGACTTCATGTACAGAACTTGGAGTGCAGGTGGCAAGCCAAGTGTTTATT...............CCTATGGGA---GCCACTGTTTCAATACTGCCTTTGGATTTTAGCATAATTATCAAATCGGTAGTCGCTAAACTGCGTCCCTCCCTTGTAGTCTTTTCTGAAGGGGACTGCTGGCTAAATTTTATTGAGGAAGCAAAACGTATAGGAGCAACTACTCTCGTCATTAATGGTAGAATTTCCATAGATTCTTCAAAGCGTTTTAAA......TTTTTAAAGCGCCTAGGTAAAAACTATTTCTCTCCAGTAGATGGATTTTTATTACAGGACGAAGTCCAAAAACAGCGTTTTCTTTCTTTAGGGATACCT------------GAACATAAATTGCAGGTTACAGGGAATATTAAGACCTATGTAGCAGCACAGACAGCACTG
TRN  10010101100011000
NAM  KDTA_CHLTR/36-225
ASQ  YIDSWKIRFG-VQKPFVKGEGPLVWFHGASVGEVSLLAPLLNRWREEFPEWRFVVTTCSEAGVHTARRLYE.....SLG-ATVFVLPLDLSCIIKSVVRKLAPDIVIFSEGDCWLHFLTESKRLGAKAFLINGKLSEHSCKRFS..FLKRLGRNYFAPLDLLILQDELYKQRFMQIGIS----SDKIHVTGNMKTFIESSLAT
DSQ  TATATTGACTCTTGGAAAATTCGGTTTGGG---GTACAGAAACCTTTTGTGAAGGGGGAAGGCCCTTTAGTTTGGTTTCATGGAGCTTCTGTGGGGGAAGTCAGTCTGTTGGCTCCCCTTCTTAATCGATGGAGAGAAGAGTTTCCAGAATGGCGGTTTGTTGTTACAACGTGTTCTGAAGCTGGTGTGCACACCGCTCGTCGTTTGTATGAA...............TCTCTTGGC---GCTACTGTATTTGTTTTACCTCTGGATTTAAGTTGTATTATTAAATCCGTGGTTCGCAAGCTTGCTCCTGATATCGTGATCTTTTCAGAAGGAGACTGTTGGTTACATTTTTTGACAGAATCCAAACGTTTAGGGGCAAAAGCCTTTTTGATTAATGGCAAACTTTCGGAACATTCTTGTAAGCGTTTTTCT......TTTTTAAAGCGGTTAGGAAGGAATTATTTTGCTCCGTTAGATTTATTGATACTACAAGACGAGCTGTATAAACAACGGTTTATGCAGATAGGTATTTCC------------TCGGATAAGATTCATGTCACTGGAAACATGAAAACGTTTATAGAATCCTCTCTTGCCACA
TRN  10010101100011000
NAM  KDTA_CHLMU/35-228
ASQ  YINSWKIRFG-VEKPQVKGEGPLVWFHGASVGEVSLLEPLLKKWRQEFPDWRFVVTACSEAGVYTAQRLYA.....PLG-ATVFVLPLDLSCIINPVVRSLSPQVVIFSEGDCWLHFLMGAKKLGAKAFLINGKLSENSCKRFA..FLKRLGRSYFAPLDLLVLQDKVYKQRFMQIGIPEDKIQISGNLKTFIETETSINNRS
DSQ  TATATCAATTCTTGGAAAATTCGATTTGGA---GTAGAAAAACCACAAGTTAAGGGGGAAGGTCCCTTGGTTTGGTTCCATGGGGCATCGGTAGGAGAGGTTTCTCTTTTGGAGCCCCTTCTTAAGAAGTGGAGACAAGAATTCCCTGATTGGCGTTTTGTGGTTACGGCATGTTCTGAGGCTGGTGTATATACTGCGCAACGTTTGTATGCT...............CCGCTCGGG---GCAACAGTGTTTGTTTTGCCCCTCGATCTAAGCTGTATTATCAATCCTGTTGTTCGTAGTCTATCTCCTCAGGTGGTTATTTTTTCAGAAGGAGATTGTTGGCTCCATTTTTTAATGGGAGCCAAGAAGTTAGGAGCTAAGGCTTTTTTGATTAATGGCAAACTTTCAGAAAATTCCTGTAAGCGTTTTGCT......TTTTTAAAGCGTTTAGGAAGAAGTTACTTTGCTCCATTAGACTTATTGGTTTTGCAAGACAAGGTGTATAAACAACGGTTTATGCAGATAGGTATTCCTGAAGATAAAATACAAATTTCAGGGAACTTGAAAACATTCATAGAAACAGAGACTTCTATAAATAATAGAAGC
TRN  10010101110011000
NAM  O66663_AQUAE/1-175
ASQ  MQFEVLKRFFP--KESLKNCKGALWVHTASIGEFNTFLPILKELKR---EHRILLTYFSPRAREYLKTKSD.....FY--DCLHPLPLDNPFSVKRFEELSKPKALIVVEREFWPSLIIFT---KVPKILVN------A---YA..KGSLIEKILSKKFDLIIMRTQEDVEKFKTFGAKR--VFSCGNLKFICQKGKGIKLKG
DSQ  ATGCAATTTGAAGTCCTGAAGAGGTTTTTCCCT------AAAGAGAGTCTGAAAAATTGCAAAGGAGCTTTATGGGTTCACACAGCAAGTATAGGAGAATTCAATACTTTCCTACCTATCCTTAAAGAACTAAAAAGA---------GAACACAGAATTCTGCTCACTTACTTTTCCCCCCGTGCAAGGGAATACCTAAAGACAAAAAGTGAT...............TTTTAC------GACTGCCTTCATCCTCTCCCTCTTGATAACCCATTTTCCGTAAAGAGATTTGAAGAACTATCAAAACCAAAAGCCTTAATAGTAGTTGAAAGGGAATTCTGGCCCTCTTTAATAATTTTTACT---------AAAGTTCCCAAAATCCTCGTCAAC------------------GCC---------TACGCA......AAAGGGAGTTTAATAGAGAAAATTCTCTCAAAAAAATTTGACTTAATAATAATGAGAACTCAAGAAGATGTGGAAAAATTTAAAACCTTTGGTGCAAAGAGG------GTATTTTCCTGCGGGAATTTAAAATTCATTTGTCAAAAAGGAAAAGGGATAAAATTGAAAGGT
TRN  10010101100011000
//