EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04350 - PilO)
FAM  PF04350
PID  PilO
DES  Pilus assembly protein, PilO
IPR  IPR007445
ANO  4
ALN  151
AID  0.319477
APH  (Q9PGD1_XYLFA/51-201:0.65611,Q51353_PSEAE/58-202:0.35766,(Q9JR13_NEIMA/50-200:1.02740,Q9KNU8_VIBCH/50-193:0.95162):0.21964);
ATP  (Q9PGD1_XYLFA/51-201,Q51353_PSEAE/58-202,(Q9JR13_NEIMA/50-200,Q9KNU8_VIBCH/50-193));
ATL  3.21243
DNO  4
DLN  453
DID  0.438875
DPH  (Q9PGD1_XYLFA/51-201:0.45471,Q51353_PSEAE/58-202:0.29147,(Q9JR13_NEIMA/50-200:0.70588,Q9KNU8_VIBCH/50-193:0.54802):0.14741);
DTP  (Q9PGD1_XYLFA/51-201,Q51353_PSEAE/58-202,(Q9JR13_NEIMA/50-200,Q9KNU8_VIBCH/50-193));
DTL  2.14749
RID  0.319477
RPH  (Q9PGD1_XYLFA/51-201:0.65611,Q51353_PSEAE/58-202:0.35766,(Q9JR13_NEIMA/50-200:1.02740,Q9KNU8_VIBCH/50-193:0.95162):0.21964);
RTP  (Q9PGD1_XYLFA/51-201,Q51353_PSEAE/58-202,(Q9JR13_NEIMA/50-200,Q9KNU8_VIBCH/50-193));
RTL  3.21243
LNK  Q51353_PSEAE/58-202:Q51353:U12892
LNK  Q9JR13_NEIMA/50-200:Q9JR13:AL162753
LNK  Q9KNU8_VIBCH/50-193:Q9KNU8:AE004329
LNK  Q9PGD1_XYLFA/51-201:Q9PGD1:AE003888
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9PGD1_XYLFA/51-201
ASQ  LGVLEGKERELRSEFQKQQERAVNLQPLKQQLVQMEEVLKQMLRQLPSKTEMPDLIVDISQTALSSGLVNELFQPGDEVLKEFYAEKPISLRMVGSYHQFAAFVSGVASLPRVVILTMHDMSLKPKTNKNNVSTRGLLELSGTVKTYRYLD
DSQ  CTTGGTGTGCTTGAAGGTAAAGAGCGCGAGCTGCGTTCGGAATTCCAAAAGCAGCAGGAACGTGCTGTGAACCTGCAGCCATTAAAGCAACAGTTGGTGCAGATGGAAGAGGTGCTGAAGCAGATGTTGCGGCAGTTGCCTAGTAAGACCGAAATGCCCGATCTGATTGTTGACATCTCTCAGACTGCCTTATCTAGTGGCTTGGTGAATGAGCTATTTCAACCAGGTGATGAAGTTCTTAAGGAGTTTTACGCTGAGAAGCCGATTTCTTTACGTATGGTTGGGAGCTATCACCAGTTTGCTGCTTTTGTTAGTGGCGTGGCTTCTTTACCGCGCGTAGTGATTTTGACGATGCATGATATGAGTCTCAAACCGAAAACCAATAAGAACAATGTGTCTACGCGAGGTTTGCTTGAATTGTCTGGCACAGTCAAAACTTACCGCTACTTGGAT
TRN  11011101101011010
NAM  Q51353_PSEAE/58-202
ASQ  LEQQAAEEETLKQQFSTKAFQAANLEAYKAQMKEMEESFGALLRQLPSDTEVPGLLEDITRTGLGSGLEFEEIKLLPEVAQQFYIELPIQISVVGGYHDLATFVSGVSSLPR--IVTLHDFEIKPVAP--GSTSK--LRMSILAKTYRYND
DSQ  CTCGAACAGCAGGCCGCGGAAGAGGAGACGCTCAAGCAGCAGTTCTCCACCAAGGCCTTCCAGGCCGCGAACCTGGAAGCCTACAAGGCACAGATGAAGGAGATGGAAGAGTCCTTTGGCGCCTTGCTGCGGCAGTTGCCCAGCGACACCGAGGTACCCGGGCTGCTCGAGGACATCACTCGTACCGGCCTGGGCAGCGGCCTGGAGTTCGAGGAAATCAAGCTGCTTCCCGAGGTTGCCCAGCAGTTCTACATCGAGCTGCCGATCCAGATCAGCGTGGTCGGCGGCTACCACGACTTGGCGACCTTCGTCAGCGGCGTGTCCAGCCTGCCGCGG------ATCGTCACCCTGCATGACTTCGAGATCAAGCCGGTCGCGCCC------GGCAGCACGTCCAAG------CTGCGCATGAGCATCCTGGCCAAGACCTATCGCTACAACGAC
TRN  11011111101111111
NAM  Q9KNU8_VIBCH/50-193
ASQ  IALLKQEEETVKATLRIKANKVAVLPQIQAQLDELKERYDFLLRQLPVQKELASMLASVNQLGLDSSLTFTRIDWGERESQEFLYRLPLNIELTGSYHDIGDFSQAIAKLPR--IINFDDVDWQRVSQ-----ESSTLHFRVRAYTYQFKQ
DSQ  ATTGCGCTGTTAAAGCAGGAAGAGGAAACCGTCAAGGCGACACTGCGCATCAAAGCCAATAAAGTGGCGGTATTGCCGCAGATCCAAGCTCAGTTGGACGAGCTCAAAGAGCGTTACGATTTTTTACTGCGCCAGCTACCGGTGCAAAAAGAGTTAGCCAGCATGCTGGCGTCAGTCAACCAGCTTGGGCTCGATAGTTCGCTTACCTTTACGCGGATTGATTGGGGGGAGCGTGAAAGCCAAGAGTTTCTTTACCGCTTACCGCTCAATATCGAACTGACGGGGAGCTATCACGATATTGGCGATTTTTCGCAAGCGATTGCCAAGTTACCGCGC------ATCATCAACTTCGACGATGTGGACTGGCAGCGTGTCAGCCAA---------------GAGAGTAGCACGCTGCACTTTCGAGTCAGAGCCTACACCTACCAATTTAAGCAG
TRN  10010101100011000
NAM  Q9JR13_NEIMA/50-200
ASQ  LEEYEAKETELKNTYKQKSIDAASLNNLRDELASIRSAFDIMLKQLPTDAEIPNLVQELHQAGSSNGLRLDSVMPQPPVDDGPIKRLPYSISITGNYEQISQFTRDVGSLSRIITLESLKIAQSPENGGNPDGKSSILNLSAIATTYQAKS
DSQ  CTTGAGGAATACGAAGCAAAAGAAACCGAACTGAAAAACACCTACAAACAGAAAAGTATCGACGCGGCCAGCCTGAACAACCTGAGGGACGAACTTGCCTCAATCCGCTCTGCCTTCGATATCATGTTGAAACAGCTGCCGACAGATGCAGAAATTCCCAACCTGGTTCAAGAGCTTCATCAGGCAGGTTCGAGCAACGGCCTGCGCTTGGACAGCGTTATGCCCCAACCTCCCGTAGATGACGGCCCCATCAAAAGATTACCCTATTCCATTTCCATTACCGGAAATTACGAACAGATCAGCCAATTTACCCGCGATGTCGGCAGCCTCTCCCGAATCATTACCCTTGAGTCGCTGAAAATCGCCCAATCTCCGGAAAACGGCGGCAATCCTGACGGCAAGAGCAGCATCCTGAACCTCAGTGCCATTGCCACCACCTACCAAGCAAAATCC
TRN  10010101100011000
//