EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04335 - VirB8)
FAM  PF04335
PID  VirB8
DES  VirB8 protein
IPR  IPR007430
ANO  30
ALN  192
AID  0.257691
APH  (((((Q9KIS2_CAMJE/42-207:0.51251,((O25187_HELPY/182-347:0.36684,Q9ZKL4_HELPJ/120-286:0.34868):0.16667,((O24879_HELPY/71-238:0.00172,Q9ZN26_HELPJ/71-238:0.01049):0.00530,Q9ZEL0_HELPY/71-238:0.00000):0.56411):0.22137):0.69550,Q9ZDP0_RICPR/72-239:1.29151):0.02944,(Q9RLR6_LEGPN/49-230:1.02839,(((Q9KW40_9RICK/53-222:0.08320,Q9KW47_9RICK/53-222:0.03954):0.40030,Y289_RICPR/72-239:0.87449):0.52156,((Q9F527_ECOLI/68-239:0.73919,((Q9RPX7_BRUME/62-232:0.36255,(O50335_ECOLI/55-225:0.44871,Q46703_ECOLI/56-228:0.84202):0.17658):0.13413,((Q9AGG9_ACTAC/48-225:0.00822,Q9F250_ACTAC/48-225:0.01493):0.51351,Q9EUF3_ECOLI/57-235:1.12586):0.28285):0.15949):0.10972,(Q981S1_RHILO/61-230:1.10475,((Q9F595_AGRRH/58-225:0.13331,((VIRB8_AGRT5/58-225:0.04550,((VIRB8_AGRTU/51-218:0.00000,Q52608_9ZZZZ/51-218:0.00000):0.00616,VIRB8_AGRT9/51-218:0.00000):0.03845):0.01076,O66288_9RHIZ/58-225:0.02196):0.04940):1.24630,(Q9PHJ3_XYLFA/53-222:0.44822,Q9RND0_BARHE/29-197:0.57223):0.17330):0.09570):0.17376):0.07993):0.22488):0.15558):1.41611,O25265_HELPY/53-225:0.00000):0.00000,Q9ZLU7_HELPJ/53-225:0.00000,Q9JMX5_HELPY/53-225:0.00000);
ATP  (((((Q9KIS2_CAMJE/42-207,((O25187_HELPY/182-347,Q9ZKL4_HELPJ/120-286),((O24879_HELPY/71-238,Q9ZN26_HELPJ/71-238),Q9ZEL0_HELPY/71-238))),Q9ZDP0_RICPR/72-239),(Q9RLR6_LEGPN/49-230,(((Q9KW40_9RICK/53-222,Q9KW47_9RICK/53-222),Y289_RICPR/72-239),((Q9F527_ECOLI/68-239,((Q9RPX7_BRUME/62-232,(O50335_ECOLI/55-225,Q46703_ECOLI/56-228)),((Q9AGG9_ACTAC/48-225,Q9F250_ACTAC/48-225),Q9EUF3_ECOLI/57-235))),(Q981S1_RHILO/61-230,((Q9F595_AGRRH/58-225,((VIRB8_AGRT5/58-225,((VIRB8_AGRTU/51-218,Q52608_9ZZZZ/51-218),VIRB8_AGRT9/51-218)),O66288_9RHIZ/58-225)),(Q9PHJ3_XYLFA/53-222,Q9RND0_BARHE/29-197))))))),O25265_HELPY/53-225),Q9ZLU7_HELPJ/53-225,Q9JMX5_HELPY/53-225);
ATL  18.2004
DNO  27
DLN  576
DID  0.392952
DPH  (((((((Q9EUF3_ECOLI/57-235:0.64442,Q9AGG9_ACTAC/48-225:0.46734):0.07020,(((Q9KW40_9RICK/53-222:0.04026,Q9KW47_9RICK/53-222:0.06130):0.33259,Y289_RICPR/72-239:0.48124):0.16404,(Q9KIS2_CAMJE/42-207:0.41500,((O25187_HELPY/182-347:0.25748,Q9ZKL4_HELPJ/120-286:0.26949):0.11573,((O24879_HELPY/71-238:0.01589,Q9ZEL0_HELPY/71-238:0.00437):0.01159,Q9ZN26_HELPJ/71-238:0.01257):0.46865):0.12476):0.41541):0.15280):0.13858,((((Q9F595_AGRRH/58-225:0.19343,((Q52608_9ZZZZ/51-218:0.08919,O66288_9RHIZ/58-225:0.06306):0.02825,VIRB8_AGRT5/58-225:0.02239):0.07457):0.66006,(Q981S1_RHILO/61-230:0.68489,((Q46703_ECOLI/56-228:0.55168,O50335_ECOLI/55-225:0.28836):0.12162,Q9RPX7_BRUME/62-232:0.29780):0.08133):0.09605):0.09191,(Q9PHJ3_XYLFA/53-222:0.36906,Q9RND0_BARHE/29-197:0.49106):0.19567):0.09859,Q9F527_ECOLI/68-239:0.49195):0.10409):0.07529,Q9RLR6_LEGPN/49-230:0.74520):0.05275,Q9ZDP0_RICPR/72-239:0.83879):0.80708,Q9ZLU7_HELPJ/53-225:0.00460):0.00735,Q9JMX5_HELPY/53-225:0.00200,O25265_HELPY/53-225:0.00200);
DTP  (((((((Q9EUF3_ECOLI/57-235,Q9AGG9_ACTAC/48-225),(((Q9KW40_9RICK/53-222,Q9KW47_9RICK/53-222),Y289_RICPR/72-239),(Q9KIS2_CAMJE/42-207,((O25187_HELPY/182-347,Q9ZKL4_HELPJ/120-286),((O24879_HELPY/71-238,Q9ZEL0_HELPY/71-238),Q9ZN26_HELPJ/71-238))))),((((Q9F595_AGRRH/58-225,((Q52608_9ZZZZ/51-218,O66288_9RHIZ/58-225),VIRB8_AGRT5/58-225)),(Q981S1_RHILO/61-230,((Q46703_ECOLI/56-228,O50335_ECOLI/55-225),Q9RPX7_BRUME/62-232))),(Q9PHJ3_XYLFA/53-222,Q9RND0_BARHE/29-197)),Q9F527_ECOLI/68-239)),Q9RLR6_LEGPN/49-230),Q9ZDP0_RICPR/72-239),Q9ZLU7_HELPJ/53-225),Q9JMX5_HELPY/53-225,O25265_HELPY/53-225);
DTL  12.4888
RID  0.246916
RPH  ((((Q9RLR6_LEGPN/49-230:1.03829,(((Q981S1_RHILO/61-230:1.08896,((Q9F595_AGRRH/58-225:0.13355,((VIRB8_AGRT5/58-225:0.04538,Q52608_9ZZZZ/51-218:0.04531):0.01068,O66288_9RHIZ/58-225:0.02176):0.04938):1.25221,(Q9PHJ3_XYLFA/53-222:0.46015,Q9RND0_BARHE/29-197:0.56221):0.17533):0.09477):0.17226,(Q9F527_ECOLI/68-239:0.76588,((Q9RPX7_BRUME/62-232:0.34391,(O50335_ECOLI/55-225:0.43877,Q46703_ECOLI/56-228:0.85711):0.19829):0.13721,(Q9EUF3_ECOLI/57-235:1.14156,Q9AGG9_ACTAC/48-225:0.52166):0.28328):0.16273):0.10087):0.07886,((Q9KW40_9RICK/53-222:0.08306,Q9KW47_9RICK/53-222:0.03998):0.39849,Y289_RICPR/72-239:0.88004):0.52916):0.22266):0.13791,(Q9ZDP0_RICPR/72-239:1.30196,(Q9KIS2_CAMJE/42-207:0.51210,((O25187_HELPY/182-347:0.36880,Q9ZKL4_HELPJ/120-286:0.35020):0.16659,((O24879_HELPY/71-238:0.00173,Q9ZN26_HELPJ/71-238:0.01053):0.00531,Q9ZEL0_HELPY/71-238:0.00000):0.56851):0.22601):0.70764):0.04175):1.42527,Q9ZLU7_HELPJ/53-225:0.00000):0.00000,Q9JMX5_HELPY/53-225:0.00000,O25265_HELPY/53-225:0.00000);
RTP  ((((Q9RLR6_LEGPN/49-230,(((Q981S1_RHILO/61-230,((Q9F595_AGRRH/58-225,((VIRB8_AGRT5/58-225,Q52608_9ZZZZ/51-218),O66288_9RHIZ/58-225)),(Q9PHJ3_XYLFA/53-222,Q9RND0_BARHE/29-197))),(Q9F527_ECOLI/68-239,((Q9RPX7_BRUME/62-232,(O50335_ECOLI/55-225,Q46703_ECOLI/56-228)),(Q9EUF3_ECOLI/57-235,Q9AGG9_ACTAC/48-225)))),((Q9KW40_9RICK/53-222,Q9KW47_9RICK/53-222),Y289_RICPR/72-239))),(Q9ZDP0_RICPR/72-239,(Q9KIS2_CAMJE/42-207,((O25187_HELPY/182-347,Q9ZKL4_HELPJ/120-286),((O24879_HELPY/71-238,Q9ZN26_HELPJ/71-238),Q9ZEL0_HELPY/71-238))))),Q9ZLU7_HELPJ/53-225),Q9JMX5_HELPY/53-225,O25265_HELPY/53-225);
RTL  18.2169
LNK  O24879_HELPY/71-238:O24879:AE000526
LNK  O25187_HELPY/182-347:O25187:AE000559
LNK  O25265_HELPY/53-225:O25265:AE000567
LNK  O50335_ECOLI/55-225:O50335:X81123
LNK  O66288_9RHIZ/58-225:O66288:AB011800
LNK  Q46703_ECOLI/56-228:Q46703:U09868
LNK  Q52608_9ZZZZ/51-218:Q52608:J03216
LNK  Q981S1_RHILO/61-230:Q981S1:BA000013
LNK  Q9AGG9_ACTAC/48-225:Q9AGG9:AF332996
LNK  Q9EUF3_ECOLI/57-235:Q9EUF3:AJ006342
LNK  Q9F250_ACTAC/48-225:Q9F250:
LNK  Q9F527_ECOLI/68-239:Q9F527:AP002527
LNK  Q9F595_AGRRH/58-225:Q9F595:AP002086
LNK  Q9JMX5_HELPY/53-225:Q9JMX5:AF282852
LNK  Q9KIS2_CAMJE/42-207:Q9KIS2:AF226280
LNK  Q9KW40_9RICK/53-222:Q9KW40:AB045235
LNK  Q9KW47_9RICK/53-222:Q9KW47:AB045234
LNK  Q9PHJ3_XYLFA/53-222:Q9PHJ3:AE003851
LNK  Q9RLR6_LEGPN/49-230:Q9RLR6:Y19029
LNK  Q9RND0_BARHE/29-197:Q9RND0:AF182718
LNK  Q9RPX7_BRUME/62-232:Q9RPX7:AE009642
LNK  Q9ZDP0_RICPR/72-239:Q9ZDP0:AJ235271
LNK  Q9ZEL0_HELPY/71-238:Q9ZEL0:AJ132366
LNK  Q9ZKL4_HELPJ/120-286:Q9ZKL4:AE001521
LNK  Q9ZLU7_HELPJ/53-225:Q9ZLU7:AE001481
LNK  Q9ZN26_HELPJ/71-238:Q9ZN26:AE001443
LNK  VIRB8_AGRT5/58-225:P17798:X53264
LNK  VIRB8_AGRT9/51-218:P05357:
LNK  VIRB8_AGRTU/51-218:P09781:
LNK  Y289_RICPR/72-239:Q9ZDN8:AJ235271
AMK  xxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxx.....xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...............xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Y289_RICPR/72-239
ASQ  IAFVVKSKQ.-FDPFVIQLNSNTGRAAVVEPISSSMLTVDESLTRYFIKKYITARETYNPVDFATIART-TVRLFSTSAVYYNYLGYIRNKDFDPTLK.YKEDNTTFLVIKSWSKIA-------.....-DDKYIVRFSVNETSGSQLV------YNKIAVVSYDYVPMQ.LTDSELDINPVGFQVNGYRVD
DSQ  ATAGCATTTGTAGTAAAATCTAAACAG...---TTTGATCCTTTTGTGATCCAGCTTAATAGTAATACTGGACGGGCTGCGGTGGTAGAACCTATTTCATCATCAATGTTAACTGTAGACGAATCTCTTACAAGATATTTTATAAAGAAATATATAACAGCACGTGAAACATATAATCCGGTTGATTTTGCTACTATAGCTCGTACA---ACAGTAAGATTATTTTCCACAAGTGCTGTTTATTATAATTATCTTGGATATATAAGAAATAAAGATTTTGATCCTACTTTAAAA...TATAAAGAAGATAATACTACATTTTTAGTAATAAAGTCATGGTCCAAAATCGCA---------------------...............---GACGATAAATATATAGTTAGATTTTCTGTAAATGAAACATCAGGAAGTCAATTAGTT------------------TATAATAAAATAGCGGTAGTAAGTTATGATTATGTGCCTATGCAA...TTAACAGATTCAGAACTTGACATAAATCCAGTAGGGTTTCAAGTTAACGGATATAGGGTAGAC
TRN  10010101110011000
NAM  Q9KW47_9RICK/53-222
ASQ  IFKISTSST.-IEPFVIEIDKKSGIVQLVDPVTVKQYSANETLNDYFISEYIKAREVFDPYNYNYNYYTK-VRLFSSPSVYSEFSNYIKSQNMNDLFN.LYSDAKGELKIRSIQKLG-------.....-NDALQVRFSIEFTRKDGNS----SRKNKIVVMSYKYASLE.MNDQQRYINPLGFQVISYRVD
DSQ  ATATTTAAAATTAGCACAAGTAGCACT...---ATTGAGCCATTCGTTATAGAAATTGACAAAAAGTCAGGAATAGTGCAATTGGTTGATCCTGTTACAGTAAAACAATATTCTGCAAATGAAACGCTGAACGATTATTTTATTTCAGAGTATATAAAAGCAAGGGAGGTTTTTGACCCATATAATTATAATTATAATTATTATACAAAA---GTAAGGTTGTTTTCTTCACCTAGTGTATATAGTGAATTTAGCAATTATATAAAATCGCAGAATATGAATGACCTTTTTAAT...TTATATTCAGATGCTAAAGGTGAGTTGAAAATTCGTTCAATTCAAAAATTAGGT---------------------...............---AACGATGCTCTTCAAGTGAGATTTTCTATAGAATTTACACGAAAAGATGGAAATTCC------------TCAAGGAAAAATAAGATAGTTGTGATGTCATATAAATATGCATCGCTTGAA...ATGAATGATCAGCAAAGATATATTAACCCGTTAGGGTTTCAAGTTATTTCATATAGAGTAGAT
TRN  10010101100011000
NAM  Q9KW40_9RICK/53-222
ASQ  IFKISTSST.-IEPFVIEIDKKSGIVQLVDPVTVKQYSADEALNDYFISEYIKAREVFDPYHYNYNYYTK-VRLFSSPNVYNEFRNYVGSQNMDDLFN.LYSDTKSEFKIRSIQKLG-------.....-NDALQVRFFVEFTRKDGSS----TRKNKIVIMSYRYASLK.MDDQQRYINPLGFQVISYRVD
DSQ  ATATTTAAAATTAGCACAAGTAGCACT...---ATTGAGCCATTTGTTATAGAAATTGACAAGAAATCAGGAATAGTGCAATTGGTTGATCCTGTCACAGTAAAACAGTATTCTGCAGATGAAGCGCTAAACGATTATTTTATTTCAGAGTATATAAAAGCAAGGGAGGTTTTTGATCCATATCATTATAATTATAACTATTATACAAAG---GTGAGGTTGTTTTCCTCACCTAATGTGTATAATGAATTTAGAAATTATGTAGGATCGCAGAATATGGATGATCTTTTTAAT...TTATATTCAGATACCAAAAGTGAATTTAAAATTCGCTCAATTCAAAAGTTGGGT---------------------...............---AACGATGCTCTTCAGGTGAGATTTTTTGTGGAATTTACACGGAAAGATGGAAGTTCT------------ACGAGAAAAAATAAGATAGTTATTATGTCATATAGATATGCATCGCTTAAA...ATGGATGATCAGCAAAGATATATTAACCCATTAGGATTTCAAGTTATTTCATATAGAGTAGAT
TRN  10010101110011000
NAM  Q9RPX7_BRUME/62-232
ASQ  IAGMLPLKQ.-HVPYLVRVNAQTGAPDILTSLDEKSVSYDTVMDKYWLSQYVIARETYDWYTLQKDYET--VGMLSSPSEGQSYASQFQGDKALDKQ-.YGSNVRTSVTIVSIVPNG-------.....-KGIGTVRFAKTTKRTNETGD--GETTHWIATIGYQYVNPSlMSESARLTNPLGFNVTSYRVD
DSQ  ATCGCCGGGATGTTACCGCTAAAGCAA...---CATGTGCCCTACCTGGTGCGCGTCAACGCACAGACAGGTGCGCCTGATATCCTGACCTCGCTCGACGAGAAGAGTGTCAGCTACGACACTGTAATGGATAAATACTGGCTCTCGCAGTACGTGATAGCGCGTGAAACCTACGACTGGTACACGCTGCAAAAGGACTACGAAACC------GTAGGCATGTTGTCGTCGCCGTCCGAAGGGCAGAGCTATGCAAGCCAGTTCCAGGGCGATAAGGCGCTTGACAAGCAA---...TATGGCTCAAATGTGCGCACATCGGTAACGATCGTAAGCATCGTGCCGAACGGC---------------------...............---AAGGGCATCGGCACGGTGCGCTTTGCGAAGACGACAAAGCGCACCAACGAGACCGGTGAT------GGCGAAACAACGCACTGGATCGCCACCATTGGCTACCAATACGTCAATCCCTCTttgATGTCGGAATCGGCCCGCCTGACAAACCCGCTGGGTTTCAATGTCACGAGCTATCGCGTTGAT
TRN  10010101100011000
NAM  O50335_ECOLI/55-225
ASQ  VCGIVGFSQpAPAPLVLRVDNATGAVDVVTTLREHESSYGEVVDTYWLNQYVLNREAYDYNTIQMNYDT--TALLSAPAVQQDYYKLFDGSNARDRV-.LGNKARITVRVRSIQPNG-------.....-RGQATVRFTTQQHNSNGTVE---RPQHQIATIGYTYIGAP.MRSSDRLLNPLGFQVTSYRAD
DSQ  GTGTGTGGAATTGTCGGGTTCTCCCAAccgGCTCCCGCGCCCTTGGTGCTTCGGGTGGATAACGCCACGGGTGCCGTCGATGTGGTGACGACGCTGCGCGAGCATGAGTCCAGCTATGGCGAAGTGGTCGATACGTACTGGCTCAATCAGTACGTGCTCAATCGCGAAGCCTACGACTACAACACAATCCAAATGAACTATGACACG------ACGGCGCTATTGAGCGCCCCGGCGGTTCAGCAGGATTACTACAAGCTCTTTGACGGCTCGAATGCGCGTGATCGGGTC---...TTGGGGAACAAAGCCCGCATTACCGTTCGGGTGCGCTCCATCCAACCTAATGGC---------------------...............---CGCGGCCAAGCGACGGTGCGCTTTACGACGCAACAGCACAACAGCAATGGCACGGTCGAA---------CGTCCGCAACATCAGATAGCGACGATTGGCTATACCTACATCGGTGCGCCG...ATGCGTTCATCTGATCGGTTGCTTAACCCTCTTGGTTTCCAGGTCACAAGCTATCGCGCTGAC
TRN  10010101100011001
NAM  Q46703_ECOLI/56-228
ASQ  LVGYVVHKYsQPIPAHLLTLNEATHEVQQVKLTRDQTSYGDEIDKFWLTQYVIHRESYDFYSVQVDYTA--VALMSTPNVAESYQSKFKGRNGLDKV-.LGDSETARVKINSVILDK-------.....PHGVRTIRFTTVRRVRTNPVD--DQPQRWIAIMGYEYKSLA.MNAEQRYVNPLGFRVTSYRVN
DSQ  TTAGTTGGTTACGTAGTGCATAAGTACagcCAGCCAATCCCCGCACATCTGCTAACGCTCAACGAGGCCACTCACGAAGTACAGCAGGTCAAGCTGACCCGCGACCAGACCTCTTATGGTGACGAAATTGATAAGTTCTGGCTGACACAATATGTCATTCACCGTGAGAGCTATGACTTCTATTCAGTTCAGGTCGACTATACGGCC------GTTGCGTTAATGTCCACGCCGAACGTGGCAGAGTCTTACCAGAGCAAGTTCAAGGGCCGCAATGGTCTTGATAAGGTT---...CTGGGCGACAGTGAAACAGCCCGCGTGAAGATTAACTCTGTGATCCTCGATAAA---------------------...............CCGCACGGCGTACGAACAATACGCTTTACTACGGTTCGCCGCGTGCGCACGAATCCCGTTGAT------GATCAGCCGCAGCGCTGGATTGCCATTATGGGGTATGAATATAAATCGCTGGCG...ATGAATGCTGAGCAGCGTTATGTCAACCCGCTGGGTTTCCGCGTGACGAGTTATCGCGTCAAC
TRN  10010101100011000
NAM  Q9F250_ACTAC/48-225
ASQ  TVSILPLRE.-VVPFLIRDNGT-GIPDVITRLDVETLTTDDAMDKHFISQYITNREGYYFNTXQQEYEL--TQMMSSDEVAKDYRSIYEGKNARDQK-.LGSSNTVKPEINSIVLSKKEVGTDG....qASNIATAR-VRLIQRNLSTGE--ETAKNIVVSLTYEYLPVKnMVEGFRMDNPLGFIVTHYRVD
NAM  Q9AGG9_ACTAC/48-225
ASQ  IVSILPLRE.-VVPFLIRDNGT-GIPDVITRLDVETLTTDDAMDKHFISQYIKTREGYYFNTLQQEYEL--TQMMSSDEVAKDYRSIYEGKNARDQK-.LGSSNTVKPEIISIVLSKKEVGTDG....qASNIATAR-VRLIQRNLSTGE--ETAKNIVVSLTYEYLPVKnMVEGFRMDNPLGFIVTHYRVD
DSQ  ATTGTCAGTATTTTACCGTTGCGCGAG...---GTTGTACCATTTCTGATTCGTGATAACGGTACG---GGTATTCCCGACGTTATTACTCGTTTGGATGTGGAAACGTTGACCACGGATGACGCCATGGATAAACATTTCATCAGTCAATATATCAAAACACGTGAAGGCTATTATTTCAACACCTTGCAACAAGAATATGAACTT------ACGCAAATGATGAGTAGTGATGAAGTTGCGAAGGATTATCGTAGCATTTATGAAGGTAAGAATGCACGTGACCAAAAA---...TTAGGTAGTAGTAACACCGTTAAACCAGAAATCATTTCTATTGTGTTATCTAAAAAAGAAGTTGGTACGGATGGC............caaGCAAGCAATATTGCCACTGCCCGC---GTTCGTTTAATTCAACGTAATTTGTCAACTGGAGAA------GAAACGGCAAAAAATATTGTAGTTTCTTTAACTTATGAATATTTACCGGTAAAAaatATGGTTGAAGGGTTCCGCATGGATAACCCATTAGGATTTATTGTGACACATTACCGGGTAGAT
TRN  11011101101011000
NAM  Q9RND0_BARHE/29-197
ASQ  VAALTPLKT.-VEPFVIRVDNSTGIIETVSALKETPNDYDEAITRYFASKYVRAREGFQLSEAEHNFRL--VSLLSSPEEQSRFAKWYAGNNPESPQ-.NIYQNMIATVTIKSISFLS------.....-KDLIQVRYYKTVRELNDKE----NISHWVSILNFSYINAQ.ISTQDRLINPLGFQVSEYRSD
DSQ  GTAGCAGCCTTAACACCCTTAAAAACA...---GTAGAGCCCTTTGTGATCCGCGTTGATAATTCAACGGGCATTATTGAAACTGTGAGTGCCTTAAAAGAAACGCCAAACGACTATGATGAAGCGATAACACGCTATTTTGCCAGCAAATATGTTCGTGCCCGTGAAGGTTTTCAATTATCAGAGGCGGAACATAATTTTCGCTTA------GTCTCTCTTTTATCTTCCCCAGAAGAACAAAGCCGTTTTGCGAAATGGTATGCAGGCAACAATCCAGAAAGTCCACAA---...AATATCTACCAAAACATGATTGCTACAGTCACAATCAAATCAATCTCTTTTTTAAGC------------------...............---AAGGATCTTATTCAAGTTCGTTATTATAAGACGGTCAGAGAATTGAATGACAAAGAA------------AATATTTCCCATTGGGTTTCGATCTTAAATTTTTCCTACATTAATGCACAA...ATTTCAACACAGGACCGATTAATTAACCCGCTTGGCTTTCAAGTGTCGGAATATAGATCTGAT
TRN  10010101110011000
NAM  Q9PHJ3_XYLFA/53-222
ASQ  VAALTPLKT.-TEPYVIRVNNNTGAVDVVKAMKEGKTNYDEAINKYFVQWYVRYRESYSRELAEDYYSY--VGIFSNDVEQQKYSAAFNPKNPQSPL-.NIYGTYAKVKIDIQSTSFI------.....HSNVALVRYTKKVERGLDQP----QITHWLATITFKYLNTP.MKEKDRGINPLGFQVSEYRND
DSQ  GTTGCCGCGCTGACACCATTGAAGACT...---ACGGAACCCTACGTTATCCGCGTGAATAACAACACGGGCGCGGTCGATGTGGTAAAGGCCATGAAGGAAGGCAAGACAAACTACGACGAGGCCATAAACAAGTATTTTGTTCAATGGTACGTCCGCTATCGTGAAAGCTATTCAAGAGAACTGGCCGAAGATTACTACTCGTAT------GTTGGTATCTTTTCTAACGACGTTGAACAGCAAAAGTATTCTGCTGCGTTTAATCCGAAAAACCCGCAATCGCCGCTG---...AATATCTATGGCACTTACGCCAAGGTCAAGATTGATATTCAAAGCACCTCGTTCATC------------------...............CATTCAAATGTCGCCTTGGTTCGTTACACCAAGAAGGTAGAACGTGGCCTTGATCAGCCG------------CAAATCACCCATTGGCTCGCGACAATCACATTCAAGTATTTGAACACCCCC...ATGAAGGAGAAAGACAGGGGAATTAACCCGCTTGGCTTCCAAGTATCCGAATACCGCAATGAC
TRN  10010101100011001
NAM  Q9F527_ECOLI/68-239
ASQ  IASLAPLKT.-AVPFLVRVDNSTGYTDIAPQLSDAKESYQDVETKYFLSKYLINYEAYDWQTIQEQADT--VKTMSSQKVFSAYDTMIRADSSPLNI-.LKNNYKIKVQINSVILLR-------.....-KDMAQVRFKKMVLDLSGKPAPGYRATEWISTISFDWDKDI.KTEKERLVNPLGLQVLSYQPD
DSQ  ATAGCCTCTCTTGCTCCATTAAAAACC...---GCTGTACCGTTCCTTGTGCGAGTGGATAACAGCACTGGATATACTGATATTGCCCCTCAATTATCTGATGCTAAGGAAAGTTATCAGGATGTTGAGACTAAATATTTCCTGTCAAAATATCTCATTAACTATGAAGCATACGACTGGCAGACCATCCAGGAACAGGCCGATACA------GTAAAAACAATGTCTTCCCAAAAGGTGTTTTCAGCTTATGACACCATGATTCGTGCTGATTCCTCACCACTGAACATT---...CTGAAAAACAACTACAAAATTAAGGTCCAGATTAATTCAGTAATCCTTCTAAGG---------------------...............---AAGGATATGGCGCAGGTGCGTTTCAAAAAAATGGTACTGGATTTATCTGGTAAACCCGCCCCCGGATACAGAGCAACAGAGTGGATTTCGACGATTTCTTTTGACTGGGATAAAGATATC...AAAACAGAAAAAGAGCGCCTTGTGAATCCGCTGGGACTGCAAGTTCTGAGCTACCAACCTGAT
TRN  10010101100011000
NAM  Q981S1_RHILO/61-230
ASQ  LILALPLKT.-YEPYMVVVDKSTGFVEVKRPLADGPLQQDESMGMFDIVRYVKARETYDPKALKDNFDL--AQLLSTGDASRELVELFSPANKVTNP-.VVLYGRNTVVAVTVKSVTFP-----.....NQRTALVRFMTEEKSQANTV----Q-RHWVSLIRFRYTGVP.AKNEIRFQNPLGFQVLEYRRD
DSQ  CTGATCCTTGCGCTGCCGCTCAAGACT...---TATGAGCCCTACATGGTGGTGGTCGACAAATCCACCGGGTTTGTCGAGGTCAAGCGGCCGCTGGCCGACGGTCCTTTGCAGCAGGACGAGTCGATGGGGATGTTCGATATCGTCCGTTATGTGAAGGCTCGCGAGACCTACGATCCGAAGGCGCTGAAGGACAACTTCGATCTC------GCGCAATTGCTGAGCACCGGCGATGCCTCGAGGGAGCTCGTCGAGCTTTTCAGCCCGGCGAACAAGGTGACGAACCCG---...GTCGTGCTCTACGGGCGAAACACCGTCGTGGCTGTGACCGTGAAGTCCGTGACATTTCCC---------------...............AACCAGAGGACCGCCCTGGTCCGGTTCATGACTGAGGAAAAGAGCCAGGCGAACACCGTG------------CAG---CGGCATTGGGTGTCGTTGATCCGGTTCCGCTACACCGGCGTGCCA...GCTAAAAACGAGATCCGCTTTCAAAATCCGCTCGGCTTCCAGGTGCTCGAATATCGGCGCGAT
TRN  10010101100011011
NAM  Q9EUF3_ECOLI/57-235
ASQ  LNAALPLKE.-TLVEAYLINSVNGVAERLTSVKKENLSENEALAKYFINQYVKRREGYNYFSLQHDYDY--VLLYSAENVATDYNALINGNNSPKVIY.KKAEQTATVQDDPSIILSSSSRADD.....KDKGAYIRFRLTIRDVATGTE---KQQYWNVRLTYRIEPQIeMASGERNNNPLKFVVTSYARD
DSQ  CTTAATGCCGCTCTTCCGCTGAAAGAA...---ACCTTAGTTGAAGCTTACTTAATTAATAGTGTTAATGGTGTTGCTGAAAGGTTGACTTCAGTTAAAAAAGAAAACCTTTCCGAAAATGAAGCTTTGGCTAAGTATTTTATCAATCAGTATGTAAAACGCAGAGAGGGTTATAACTACTTTAGTCTTCAGCATGATTATGATTAT------GTTCTGCTGTACAGTGCTGAAAATGTTGCTACTGATTACAATGCTCTAATCAATGGCAATAATTCGCCAAAAGTTATTTAT...AAGAAAGCAGAGCAAACGGCAACAGTACAGGATGATCCATCAATAATCTTAAGCTCATCATCACGCGCTGATGAT...............AAAGATAAAGGTGCTTATATTCGCTTCCGTTTAACAATCCGAGACGTAGCAACTGGCACAGAG---------AAACAGCAATATTGGAATGTTAGGTTAACTTATCGCATCGAACCGCAGATAgaaATGGCATCGGGCGAAAGAAACAACAACCCTCTTAAGTTTGTAGTAACTAGCTATGCTCGTGAT
TRN  10010101100011000
NAM  VIRB8_AGRT9/51-218
ASQ  IATMVPLSR.-LVPVYLWIRPD-GTVDSEVSISRLPATQEEAVVNASLWEYVRLRESYDADTAQYAYDL--VSNFSAPTVRQDYQQFFNYPNPSSPQ-.VILGKRGRVEVEHIASNDV------.....TPSTQQIRYKRTLVVDGKMP----VVSTWTATVRYEKVTS-.LPGRLRLTNPAGLVVTSYQTS
NAM  Q52608_9ZZZZ/51-218
ASQ  IATMVPLSR.-LVPVYLWIRAD-GTVDSEVSISRLPATQEEAVVNASLWEYVRLRESYDADTAQYAYDL--VSNFSAPTVRQDYQQFFNYPNPSSPQ-.VILGKRGRVEVEHIASNDV------.....TPSTQQIRYKRTLVVDGKMP----VVSTWTATVRYEKVTS-.LPGRLRLTNPAGLVVTSYQTS
DSQ  ATAGCTACCATGGTGCCGTTGAGCAGG...---CTTGTGCCCGTATATCTATGGATACGCGCGGAC---GGCACCGTTGACAGCGAGGTGTCTATCTCGCGATTGCCTGCAACTCAAGAGGAGGCCGTCGTTAACGCTTCATTGTGGGAGTACGTTCGCCTGCGTGAGAGTTATGATGCCGATACCGCTCAGTACGCCTACGACCTA------GTATCGAACTTCAGTGCCCCAACAGTGCGCCAGGATTACCAGCAATTCTTCAACTATCCCAATCCCAGTTCGCCTCAA---...GTCATTCTTGGCAAACGCGGCAGGGTGGAGGTCGAGCACATCGCTTCAAATGATGTA------------------...............ACTCCAAGCACGCAGCAAATTCGCTATAAAAGGACCCTCGTCGTTGACGGCAAAATGCCT------------GTGGTGAGTACGTGGACCGCGACAGTTCGCTACGAAAAGGTGACCAGC---...TTGCCCGGCAGATTGAGATTGACCAACCCGGCAGGTCTGGTTGTCACCTCCTATCAGACCTCG
TRN  10010101100011001
NAM  VIRB8_AGRTU/51-218
ASQ  IATMVPLSR.-LVPVYLWIRAD-GTVDSEVSISRLPATQEEAVVNASLWEYVRLRESYDADTAQYAYDL--VSNFSAPTVRQDYQQFFNYPNPSSPQ-.VILGKRGRVEVEHIASNDV------.....TPSTQQIRYKRTLVVDGKMP----VVSTWTATVRYEKVTS-.LPGRLRLTNPAGLVVTSYQTS
NAM  O66288_9RHIZ/58-225
ASQ  IATMVPLIR.-LVPVYLWVRPD-GTVDSEVSVSRLPATQEEAVVNASLWEYVRLRESYDADSVQYAYDL--VSNFSAPTVRQDYQQFFNYPNPSSPQ-.VILGKRGRLAVEHIASNDV------.....TPGVQQIRYKRTLVVEGKMP----VVSTWTATVRYEKVTS-.LPGRLRLTNPGGLVVTSYQTS
DSQ  ATTGCTACCATGGTGCCGCTGATCAGG...---CTCGTGCCGGTATACCTATGGGTACGGCCGGAC---GGAACAGTCGACAGCGAGGTATCCGTCTCCCGACTGCCGGCAACACAAGAGGAGGCCGTCGTTAACGCCTCACTGTGGGAATATGTTCGGTTGCGCGAGAGTTATGATGCCGATAGCGTTCAGTACGCCTATGACCTG------GTATCGAACTTCAGCGCCCCGACAGTGCGCCAAGATTATCAGCAATTCTTCAACTATCCTAACCCAAGTTCCCCTCAA---...GTCATCCTCGGGAAACGCGGTAGGCTGGCGGTCGAACACATCGCTTCAAATGATGTC------------------...............ACCCCGGGTGTGCAGCAAATCCGGTATAAACGAACCCTCGTCGTTGAGGGCAAAATGCCG------------GTCGTGAGTACTTGGACTGCCACAGTTCGCTATGAAAAGGTGACCAGC---...TTGCCCGGTAGATTGAGGTTGACCAATCCGGGAGGCTTGGTTGTCACCTCCTACCAGACATCG
TRN  10010101100011001
NAM  VIRB8_AGRT5/58-225
ASQ  IATMVPLIR.-LVPVYLWIRPD-GTVDSEVSVSRLPATQEEAVVNASLWEYVRLRESYDADTAQYAYDL--VSNFSAPMVRQNYQQFFNYPNPTSPQ-.VILGKHGRLEVEHIASNDV------.....TPGVQQIRYKRTLIVDGKMP----MASTWTATVRYEKVTS-.LPGRLRLTNPGGLVVTSYQTS
DSQ  ATTGCCACCATGGTGCCGCTGATCAGG...---CTTGTGCCGGTATATCTTTGGATACGGCCGGAT---GGCACCGTTGACAGCGAGGTGTCCGTCTCCCGATTGCCTGCAACTCAAGAGGAGGCCGTCGTTAACGCCTCACTGTGGGAGTATGTTCGGCTGCGCGAGAGCTATGATGCCGATACCGCCCAGTATGCCTATGACCTG------GTCTCGAACTTCAGCGCCCCAATGGTGCGCCAAAATTATCAGCAATTCTTCAATTATCCCAATCCAACTTCGCCTCAA---...GTCATCCTCGGCAAACACGGCAGGCTAGAGGTCGAACACATCGCTTCGAATGATGTT------------------...............ACTCCGGGTGTGCAGCAAATTCGCTATAAGCGAACCCTCATCGTTGACGGCAAAATGCCG------------ATGGCGAGCACTTGGACTGCTACGGTTCGTTATGAAAAGGTGACCAGC---...TTGCCCGGCAGATTGAGACTGACCAACCCGGGAGGCTTGGTTGTCACCTCCTACCAGACATCG
TRN  10010101100011001
NAM  Q9F595_AGRRH/58-225
ASQ  IAVMLPLNK.-LVPVYLWVRPD-GTVDSEVSISRLPATQEQAVVNASLWEYVRLRESYSADTAQYAYDL--VSSFSAPTVRQDYQQFFNYPSPSSPQ-.TIIGKRGKLEAEHIGSNEL------.....MPGVQQIRYKRTLIMEGQAP----IVTTWTATVHYETVTN-.LPGRLRLTNPGGLIVTSYQTS
DSQ  ATCGCCGTCATGCTTCCGCTGAACAAA...---CTTGTTCCAGTATATCTGTGGGTGCGCCCAGAC---GGTACAGTTGACAGTGAGGTATCTATTTCGCGGTTGCCGGCGACGCAGGAGCAAGCGGTCGTGAATGCGTCTCTATGGGAGTATGTTCGTCTGCGGGAGAGCTACTCGGCGGATACAGCCCAATACGCCTATGATCTG------GTCTCGAGCTTCAGTGCCCCAACGGTGCGTCAAGATTATCAGCAGTTCTTCAATTACCCCAGTCCTAGCTCCCCCCAA---...ACCATCATTGGTAAGCGCGGAAAGCTGGAAGCCGAGCACATCGGCTCGAACGAACTT------------------...............ATGCCTGGCGTCCAGCAGATCCGCTACAAACGCACTCTCATCATGGAAGGGCAAGCTCCA------------ATAGTAACCACCTGGACCGCAACGGTACATTATGAAACGGTAACTAAC---...TTGCCCGGCCGATTGAGGCTGACAAATCCAGGCGGCTTAATCGTTACCTCCTATCAAACTTCG
TRN  10010101100011010
NAM  Q9RLR6_LEGPN/49-230
ASQ  IGMLAHYQT.-VVPMLVHHYDN--GVTTVEPMENKLTPINRAQIESDIARYIQYRESYDASSYRAQFEL--VHLLSNSTVAKEYLQEQDAANTASPIHaLGNHIKREVRIYSINFLDSVLANEKdlhkdHHALAEVVFSLIDTDKTSGKT---TSTHYNAMISWRYTNPP.DSPETRWKNWDGFEVTRYSRQ
DSQ  ATAGGCATGCTCGCACATTATCAAACC...---GTAGTGCCGATGCTGGTTCATCATTACGACAAT------GGGGTTACTACCGTTGAACCCATGGAAAATAAACTAACACCGATAAATCGCGCACAGATTGAAAGCGACATCGCCCGTTACATTCAATACCGTGAGTCTTATGATGCATCAAGCTATCGCGCTCAATTTGAATTG------GTGCACTTGTTATCCAATAGCACGGTTGCCAAGGAATATTTGCAAGAGCAAGATGCTGCAAATACTGCCTCACCCATTCATgccTTGGGGAATCATATCAAGCGAGAGGTTCGCATTTACAGCATTAACTTCCTTGATTCCGTCTTGGCGAATGAAAAAgaccttcataaagacCACCACGCATTGGCAGAAGTGGTATTCAGTTTGATTGATACCGACAAAACCAGCGGAAAAACC---------ACCTCTACGCATTACAACGCCATGATTTCATGGCGATACACCAATCCCCCG...GATTCCCCTGAAACCCGCTGGAAAAACTGGGATGGATTTGAAGTCACGCGCTACTCAAGGCAA
TRN  10010101100011000
NAM  Q9ZN26_HELPJ/71-238
ASQ  LISILPLQK.-TEHHFVDFLNQ-DKHYAIIQRADKSISSNEALARSLIGAYVLNRESINRIDDKSRYEL--VRLQSSSKVWQRFEDLIKAQNSIYVQ-.SHLEREVHIVNIAIYQQD-------.....NNPIASVSIAAKLLNENKLV----YEKRYKIVLSYLFDTPD.FDYASMPKNPTGFKITRYSIT
DSQ  TTAATCAGTATCCTGCCCTTACAAAAA...---ACCGAACACCATTTCGTGGATTTTTTAAACCAG---GACAAGCATTACGCCATTATCCAAAGAGCGGATAAAAGCATTTCCAGTAATGAAGCGTTGGCTCGTTCGCTCATTGGGGCGTATGTGTTAAACCGAGAGAGCATTAATCGCATTGACGATAAATCCCGCTATGAACTG------GTGCGCTTGCAAAGCAGCTCTAAAGTGTGGCAACGCTTTGAAGATTTGATTAAAGCCCAAAACAGCATCTATGTGCAA---...AGCCATTTAGAAAGAGAAGTCCATATCGTCAATATTGCGATCTATCAGCAAGAC---------------------...............AATAACCCCATTGCGAGCGTGTCCATTGCGGCTAAACTTTTGAATGAAAACAAGCTCGTG------------TATGAAAAGCGTTATAAAATCGTATTGAGCTATTTGTTTGACACCCCGGAT...TTTGATTACGCTTCCATGCCTAAAAACCCTACCGGCTTTAAAATCACTCGCTACAGCATCACT
TRN  10010101100011010
NAM  Q9ZEL0_HELPY/71-238
ASQ  LISLLPLQK.-TEHHFVDFLNQ-DKHYAIIQRADKSISSNEALARSLIGAYVLNRESINRIDDKSRYEL--VRLQSSSKVWQRFEDLIKTQNSIYVQ-.SHLEREVHIVNIAIYQQD-------.....NNPIASVSIAAKLLNENKLV----YEKRYKIVLSYLFDTPD.FDYASMPKNPTGFKITRYSIT
DSQ  TTAATCAGTCTTCTACCCTTACAAAAA...---ACCGAACACCATTTCGTGGATTTTTTAAACCAG---GACAAGCATTACGCCATTATCCAAAGAGCGGATAAAAGCATTTCCAGTAATGAAGCGTTGGCTCGTTCGCTCATTGGGGCGTATGTGTTAAACCGAGAGAGCATTAACCGCATTGACGATAAATCGCGCTATGAATTG------GTGCGCTTGCAAAGCAGTTCTAAAGTGTGGCAACGCTTTGAAGATTTGATTAAAACCCAAAACAGCATTTATGTGCAA---...AGCCATTTGGAAAGAGAAGTCCATATCGTCAATATTGCGATCTATCAGCAAGAC---------------------...............AATAACCCCATTGCGAGCGTCTCCATTGCCGCTAAACTTTTGAATGAAAACAAGCTGGTG------------TATGAAAAGCGTTATAAAATCGTATTGAGTTATTTGTTTGACACCCCGGAT...TTTGATTACGCTTCCATGCCTAAAAACCCTACCGGCTTTAAAATCACTCGCTACAGCATCACT
TRN  10010101100011010
NAM  O24879_HELPY/71-238
ASQ  LISVLPLQK.-TEHHFVDFLNQ-DKHYAIIQRADKSISSNEALARSLIGAYVLNRESINRIDDKSRYEL--VRLQSSSKVWQRFEDLIKTQNSIYVQ-.SHLEREVHIVNIAIYQQD-------.....NNPIASVSIAAKLLNENKLV----YEKRYKIVLSYLFDTPD.FDYASMPKNPTGFKITRYSIT
DSQ  TTAATCAGTGTTCTGCCCTTACAAAAA...---ACCGAACACCATTTCGTGGATTTTTTAAATCAG---GACAAGCATTACGCCATTATCCAAAGAGCGGATAAAAGCATTTCCAGTAATGAAGCGTTGGCTCGTTCGCTCATTGGGGCGTATGTGTTAAACCGAGAGAGTATTAACCGCATTGACGATAAATCGCGCTATGAATTG------GTGCGCTTGCAAAGCAGTTCTAAAGTGTGGCAACGCTTTGAAGATTTGATTAAAACCCAAAACAGCATTTATGTGCAA---...AGCCATTTGGAAAGAGAAGTCCATATCGTCAATATTGCGATCTATCAGCAAGAC---------------------...............AATAACCCCATTGCGAGCGTCTCCATTGCGGCTAAACTTTTGAACGAAAACAAGTTGGTG------------TATGAAAAGCGTTATAAAATCGTATTGAGTTATTTGTTTGACACCCCGGAT...TTTGATTACGCTTCCATGCCTAAAAACCCTACCGGATTTAAAATCACCCGTTACAGCATCACT
TRN  10010101100011010
NAM  Q9ZKL4_HELPJ/120-286
ASQ  IVCLLPLKE.-KVPYLVTFSNA-TQNFAIVQRADKSIRANQALVRQLVASYVNNRENISSIKEQNEIAHETIRLQSAFEVWDFFEKLVSYEHSIYTN-.--INLTRKISIINIALIS-------.....-KTQANIEISAQLFHKEKLE----SEKRYRIIMTFEFEPIE.IDTKSVPLNPTGFIVTGYDVT
DSQ  ATTGTATGCTTATTGCCGTTAAAAGAA...---AAAGTGCCTTATTTAGTAACCTTTTCAAACGCT---ACACAAAATTTTGCCATAGTCCAAAGAGCAGACAAGAGCATCCGTGCTAATCAAGCGCTTGTGAGACAATTGGTAGCGTCTTATGTTAATAATAGAGAAAATATTTCAAGTATAAAAGAGCAAAACGAAATAGCCCACGAAACCATTAGGTTGCAAAGCGCATTTGAAGTGTGGGATTTTTTTGAAAAACTGGTTTCTTATGAGCATAGCATTTACACTAAT---...------ATAAATCTAACACGAAAAATTAGCATTATCAATATCGCTTTAATCAGT---------------------...............---AAAACCCAAGCCAATATTGAAATATCCGCACAACTTTTTCATAAAGAAAAGTTAGAA------------AGCGAAAAGCGTTATAGAATAATTATGACCTTTGAATTTGAACCTATTGAA...ATTGATACAAAATCTGTTCCCCTAAACCCTACAGGCTTTATTGTTACAGGTTATGATGTAACT
TRN  10010101100011000
NAM  O25187_HELPY/182-347
ASQ  LTILLPLKQ.-KEPYLVQFSNN-KENFALVQKADSSITANKALIRSLVGAYVLNRESITHIEQHEKMRQNTIKEQSSNEVWYEFEKLIAHYDSIYTN-.--PLLTRKVKIANIYLD--------.....-KDLAYIDIEVSLYHSGELE----SLKRYKVVMSFEFKKQE.INFDSMSLNPTGFMVTSYDVT
DSQ  CTGACTATTCTGTTGCCCTTAAAACAA...---AAAGAGCCGTATTTAGTGCAATTTTCTAACAAT---AAAGAAAATTTTGCTTTAGTTCAAAAGGCAGATAGCAGCATTACAGCCAATAAAGCTCTTATTCGTTCATTAGTGGGAGCGTATGTGCTAAACAGGGAAAGCATTACTCATATTGAGCAACATGAAAAAATGCGTCAAAACACCATTAAAGAGCAAAGTTCCAATGAAGTATGGTATGAATTTGAAAAACTCATCGCTCATTATGACAGCATTTACACTAAT---...------CCTTTACTCACAAGAAAAGTAAAGATTGCAAATATTTACTTAGAT------------------------...............---AAAGATTTAGCCTATATTGACATTGAAGTGAGCTTGTATCATAGTGGAGAATTAGAG------------AGCTTGAAGCGCTATAAAGTGGTGATGAGTTTTGAATTTAAAAAACAAGAA...ATCAATTTTGACTCCATGTCTTTAAATCCTACAGGCTTTATGGTTACAAGTTATGATGTAACT
TRN  10010101100011000
NAM  Q9KIS2_CAMJE/42-207
ASQ  ITFLAPFKE.-VKPYLVFFSDG-ETNFVKVEQAGMDMRADENLLKSILAGYVKKRETINRVDDSERYEE--IRLQSQKNVWETFSNLVKAPNSIYTT-.--QGVFRSIEIINVSIFN-------.....-KNVATIDFIAKITNRDGSEN---HLKKYRATLFFDFIPME.LTYNSVPKNPTGFIVKQYSIT
DSQ  ATTACTTTTCTTGCCCCTTTTAAAGAA...---GTAAAGCCTTATTTAGTATTTTTTTCAGACGGC---GAAACTAATTTTGTAAAGGTAGAACAAGCAGGAATGGATATGAGAGCCGATGAGAATTTATTAAAATCAATTCTCGCAGGCTATGTTAAAAAACGCGAAACGATAAATCGTGTCGATGATAGTGAGAGATACGAAGAG------ATCAGACTTCAATCTCAAAAAAATGTGTGGGAAACATTCTCAAACTTAGTAAAAGCTCCAAATTCTATTTATACAACG---...------CAAGGAGTTTTTAGAAGCATTGAAATTATCAATGTTTCAATTTTTAAT---------------------...............---AAAAATGTAGCTACGATCGATTTTATAGCAAAAATAACTAATAGAGATGGTAGTGAGAAC---------CATTTAAAAAAATATCGTGCCACATTATTTTTTGATTTTATACCAATGGAG...CTTACTTATAATTCAGTTCCAAAAAATCCTACAGGCTTTATTGTCAAACAATATTCAATTACA
TRN  10010101110011000
NAM  Q9ZDP0_RICPR/72-239
ASQ  INILLPIHK.-KVGYLIKDDSE-KQATITNTKHSTLANPYIAVANIMLQNYVKQREKYNYDTLKEQFTF--IKNASTSIVYMQFANFMNIDNSLSPVIrYQKLYRRSINIISINNIN-------.....-NNEATVTFESLAQNNTGEIL---ENMLWEARIGFIMDSIS.--TSTLQDMTFNFTVTSYKLK
DSQ  ATCAACATATTGTTACCAATACACAAA...---AAGGTAGGTTATTTAATAAAAGATGATTCAGAA---AAACAAGCTACCATTACTAATACTAAACATTCAACATTAGCAAATCCTTATATTGCTGTTGCGAATATTATGCTTCAGAATTATGTAAAACAACGAGAAAAATACAATTATGATACATTAAAAGAACAATTCACTTTT------ATTAAAAATGCTTCTACGAGTATTGTTTATATGCAATTTGCTAATTTTATGAATATTGATAACTCATTATCACCTGTCATAagaTATCAAAAGCTATATAGACGCTCGATTAATATAATATCAATTAACAATATCAAC---------------------...............---AATAACGAAGCAACTGTTACTTTTGAATCATTGGCGCAAAATAATACTGGTGAAATTTTA---------GAAAATATGCTATGGGAAGCAAGAATTGGATTTATAATGGATTCTATCAGT...------ACAAGTACATTACAGGATATGACATTCAATTTTACAGTGACTAGTTACAAGCTAAAA
TRN  10010101110011000
NAM  O25265_HELPY/53-225
ASQ  IVMMMPLKK.-TDIFVYGIDRYTGEFKIVKRSDARQIVNSEAVVDSATSKFVSLLFGYSKNSLRDRKDQ---LMQYCDVSFQTQAMRMFNENIRQFV-.--DKVRAE-AIISSNIQR-----EKv...kNSPLTRLTFFITIKITPDTMENYEYITKKQVTIYYDFARGN.SSQENLIINPFGFKVFDIQIT
DSQ  ATTGTGATGATGATGCCTTTGAAGAAA...---ACGGATATATTTGTTTATGGCATTGATCGATACACAGGAGAATTTAAAATTGTCAAACGCTCCGATGCTAGGCAAATCGTCAATTCTGAAGCCGTTGTGGATAGTGCAACTTCAAAATTTGTATCATTGCTGTTTGGTTATAGCAAAAATTCTTTGAGGGATCGCAAGGATCAA---------CTAATGCAGTATTGCGATGTGAGTTTCCAAACCCAAGCAATGAGAATGTTCAATGAAAATATCAGACAATTCGTA---...------GATAAAGTCCGAGCAGAA---GCTATCATTAGCTCTAACATACAAAGA---------------GAAAAAgtc.........aaaAATAGTCCCTTAACGAGATTAACATTTTTCATTACCATCAAAATCACACCTGATACAATGGAAAATTATGAATATATCACTAAAAAACAAGTAACTATTTATTATGATTTTGCTAGAGGTAAC...TCTTCTCAAGAAAATCTTATCATCAATCCTTTTGGCTTCAAAGTGTTTGACATTCAAATCACA
TRN  10010101100011000
NAM  Q9JMX5_HELPY/53-225
ASQ  IVMMMPLKK.-TDIFVYGIDRYTGEFKIVKRSDARQIVNSEAVVDSATSKFVSLLFGYSKNSLRDRKDQ---LMQYCDVSFQTQAMRMFNENIRQFV-.--DKVRAE-AIISSNIQR-----EKv...kNSPLTRLTFFITIKITPDTMENYEYITKKQVTIYYDFARGN.SSQENLIINPFGFKVFDIQIT
DSQ  ATTGTGATGATGATGCCTTTGAAGAAA...---ACGGATATATTTGTTTATGGCATTGATCGATACACAGGAGAATTTAAAATTGTCAAACGCTCCGATGCTAGGCAAATCGTCAATTCTGAAGCCGTTGTGGATAGTGCAACTTCAAAATTTGTATCATTGCTGTTTGGTTATAGCAAAAATTCTTTGAGGGATCGCAAGGATCAA---------CTAATGCAGTATTGCGATGTGAGTTTCCAAACCCAAGCAATGAGAATGTTCAATGAAAATATCAGACAATTCGTA---...------GATAAAGTCCGAGCAGAA---GCTATCATTAGCTCTAACATACAAAGA---------------GAAAAAgtc.........aaaAATAGTCCTTTAACGAGATTAACATTTTTCATTACCATCAAAATCACGCCTGATACAATGGAAAATTATGAATATATCACTAAAAAACAAGTAACTATTTATTATGATTTTGCTAGAGGTAAC...TCTTCTCAAGAAAATCTTATCATCAATCCTTTTGGCTTCAAAGTGTTTGACATTCAAATCACA
TRN  10010101100011000
NAM  Q9ZLU7_HELPJ/53-225
ASQ  IVMMMPLKK.-TDIFVYGIDRYTGEFKIVKRSDARQIVNSEAVVDSATSKFVSLLFGYSKNSLRDRKDQ---LMQYCDVSFQTQAMRMFNENIRQFV-.--DKVRAE-AIISSNIQR-----EKv...kNSPLTRLTFFITIKITPDTMENYEYITKKQVTIYYDFARGN.SSQENLIINPFGFKVFDIQIT
DSQ  ATTGTGATGATGATGCCTTTGAAGAAA...---ACAGATATATTTGTTTATGGCATTGATCGATACACAGGAGAATTTAAAATCGTCAAACGCTCCGATGCTAGGCAAATCGTCAATTCTGAAGCCGTTGTGGATAGTGCAACTTCAAAATTTGTCTCATTGCTGTTTGGTTATAGCAAAAATTCTTTGAGGGATCGCAAGGATCAA---------CTAATGCAGTATTGCGATGTGAGTTTCCAAACCCAAGCAATGAGAATGTTCAATGAAAATATCAGACAATTCGTA---...------GATAAAGTCCGAGCAGAA---GCTATCATTAGCTCCAACATACAAAGA---------------GAAAAAgtc.........aaaAATAGTCCCTTAACGAGATTAACATTTTTCATTACCATCAAAATCACGCCTGATACAATGGAAAATTATGAATATATCACTAAAAAACAAGTAACTATTTATTATGATTTTGCTAGAGGTAAC...TCTTCTCAAGAAAATCTTATCATCAACCCTTTTGGCTTCAAAGTGTTTGACATTCAAATCACG
TRN  10010101100011000
//