EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04265 - TPK_B1_binding)
FAM  PF04265
PID  TPK_B1_binding
DES  Thiamin pyrophosphokinase, vitamin B1 binding domain
IPR  IPR007373
ANO  9
ALN  76
AID  0.236389
APH  (TPK1_HUMAN/168-237:0.33540,((THI80_YEAST/234-306:1.22186,TNR3_SCHPO/496-563:0.52017):0.38918,O80514_ARATH/181-249:0.37179):0.23089,((Q99UP5_STAAM/140-206:0.88693,(Q9A1H7_STRPY/139-203:0.69000,(Q9CEL3_LACLA/138-203:0.87828,Q97NN8_STRPN/156-221:0.39518):0.54358):0.38655):0.89027,Q8T4A5_DROME/258-328:0.36107):0.32318);
ATP  (TPK1_HUMAN/168-237,((THI80_YEAST/234-306,TNR3_SCHPO/496-563),O80514_ARATH/181-249),((Q99UP5_STAAM/140-206,(Q9A1H7_STRPY/139-203,(Q9CEL3_LACLA/138-203,Q97NN8_STRPN/156-221))),Q8T4A5_DROME/258-328));
ATL  8.42433
DNO  9
DLN  228
DID  0.391668
DPH  (TPK1_HUMAN/168-237:0.21712,(Q8T4A5_DROME/258-328:0.39261,O80514_ARATH/181-249:0.47371):0.16658,(((Q99UP5_STAAM/140-206:0.72779,Q9A1H7_STRPY/139-203:0.37823):0.15111,(Q9CEL3_LACLA/138-203:0.64007,Q97NN8_STRPN/156-221:0.32772):0.21465):0.48864,(THI80_YEAST/234-306:0.69526,TNR3_SCHPO/496-563:0.39610):0.16176):0.14380);
DTP  (TPK1_HUMAN/168-237,(Q8T4A5_DROME/258-328,O80514_ARATH/181-249),(((Q99UP5_STAAM/140-206,Q9A1H7_STRPY/139-203),(Q9CEL3_LACLA/138-203,Q97NN8_STRPN/156-221)),(THI80_YEAST/234-306,TNR3_SCHPO/496-563)));
DTL  5.57515
RID  0.236389
RPH  (TPK1_HUMAN/168-237:0.33540,((THI80_YEAST/234-306:1.22186,TNR3_SCHPO/496-563:0.52017):0.38918,O80514_ARATH/181-249:0.37179):0.23089,((Q99UP5_STAAM/140-206:0.88693,(Q9A1H7_STRPY/139-203:0.69000,(Q9CEL3_LACLA/138-203:0.87828,Q97NN8_STRPN/156-221:0.39518):0.54358):0.38655):0.89027,Q8T4A5_DROME/258-328:0.36107):0.32318);
RTP  (TPK1_HUMAN/168-237,((THI80_YEAST/234-306,TNR3_SCHPO/496-563),O80514_ARATH/181-249),((Q99UP5_STAAM/140-206,(Q9A1H7_STRPY/139-203,(Q9CEL3_LACLA/138-203,Q97NN8_STRPN/156-221))),Q8T4A5_DROME/258-328));
RTL  8.42433
LNK  O80514_ARATH/181-249:O80514:AC003672
LNK  Q8T4A5_DROME/258-328:Q8T4A5:AY089282
LNK  Q97NN8_STRPN/156-221:Q97NN8:AE007487
LNK  Q99UP5_STAAM/140-206:Q99UP5:BA000017
LNK  Q9A1H7_STRPY/139-203:Q9A1H7:AE006493
LNK  Q9CEL3_LACLA/138-203:Q9CEL3:AE006412
LNK  THI80_YEAST/234-306:P35202:D14417
LNK  TNR3_SCHPO/496-563:P41888:X84417
LNK  TPK1_HUMAN/168-237:Q9H3S4:AB028138
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  TNR3_SCHPO/496-563
ASQ  GIN---HVDCHDNIG--LHCGLLPVGQSVYVKKTSGLEWNIEDRICQFGG-LVSSC-NVVT-KATVTIEVNNFIVW
DSQ  GGAATAAAT---------CATGTTGATTGTCACGACAACATTGGT------TTACATTGCGGTCTTCTGCCAGTAGGACAGAGTGTGTATGTTAAAAAAACCAGCGGCCTTGAGTGGAATATTGAGGATCGCATTTGTCAATTTGGAGGA---CTCGTCAGCTCTTGC---AATGTAGTGACA---AAAGCAACGGTGACTATAGAGGTCAACAATTTTATAGTATGG
TRN  10010101100011010
NAM  O80514_ARATH/181-249
ASQ  HRH-EIHI--HSSLQGP-HCGLIPIGTPSANTTTSGLKWDLSNTEMRFGG-LISTS-NLVK-EEIITVESDSDLLW
DSQ  CATCGACAT---GAAATACATATT------CACTCTTCTCTTCAAGGACCT---CACTGTGGACTTATACCCATTGGAACTCCATCTGCCAATACCACTACCTCAGGGCTTAAATGGGATCTCAGCAACACTGAGATGAGATTTGGTGGG---TTGATAAGTACATCG---AACTTGGTTAAA---GAAGAGATAATCACAGTCGAATCGGATTCGGATCTTCTCTGG
TRN  10010101110011001
NAM  TPK1_HUMAN/168-237
ASQ  GKH-RLHV--DTGMEGD-WCGLIPVGQPCMQVTTTGLKWNLTNDVLAFGT-LVSTS-NTYDGSGVVTVETDHPLLW
DSQ  GGAAAGCAC---AGGTTGCATGTA------GACACTGGAATGGAGGGTGAT---TGGTGTGGCCTTATTCCTGTTGGACAGCCTTGTATGCAGGTTACAACCACAGGCCTCAAGTGGAACCTCACAAATGATGTGCTTGCTTTTGGAACA---TTGGTCAGTACTTCC---AATACCTACGACGGGTCTGGTGTTGTGACTGTGGAAACTGACCACCCACTCCTCTGG
TRN  10010101110011011
NAM  Q8T4A5_DROME/258-328
ASQ  GKHTIQVP--VDLVTSQRWCSLMPVGSSAHNVTTTGLKWNLYHAQLEFGG-MVSTS-NTYA-TEFVQVETDANLIW
DSQ  GGAAAGCACACGATACAGGTGCCC------GTCGACCTGGTCACCAGCCAGCGATGGTGCTCTCTGATGCCCGTGGGATCGTCGGCCCACAATGTCACTACCACGGGACTCAAATGGAACCTATATCATGCACAGCTGGAGTTTGGTGGT---ATGGTAAGCACCTCA---AACACCTATGCG---ACCGAGTTCGTCCAGGTGGAGACGGACGCCAACCTGATCTGG
TRN  10010101100011001
NAM  THI80_YEAST/234-306
ASQ  GTLIEYDPQFRNTCIGN--CGLLPIGEATLVKETRGLKWDVKNWPTSVVTGRVSSS-NRFVGDNCCFIDTKDDIIL
DSQ  GGAACTTTGATTGAGTATGATCCCCAATTTAGGAACACTTGTATAGGAAAT------TGTGGGTTGTTGCCTATTGGAGAGGCTACTTTGGTTAAGGAAACCCGTGGTTTAAAGTGGGATGTTAAAAACTGGCCAACTAGCGTGGTCACCGGAAGAGTCAGCAGTAGT---AACAGATTTGTTGGGGATAATTGTTGTTTCATTGATACCAAAGATGACATCATTTTG
TRN  10010101110011010
NAM  Q97NN8_STRPN/156-221
ASQ  GISQLEPRSDYDYL------AFMPVRDS--QLTILGAKYELTEENFFF--KKVYASNEYIDREVSVTCPDGYVVVL
DSQ  GGAATCAGTCAGCTAGAACCTCGTTCAGACTACGACTATCTA------------------GCCTTTATGCCAGTTCGGGATAGC------CAGCTGACTATTCTTGGAGCCAAGTATGAGTTGACAGAGGAAAATTTTTTCTTT------AAAAAAGTGTACGCTTCTAACGAATATATAGATAGGGAAGTGTCGGTAACTTGCCCAGATGGTTATGTGGTCGTACTG
TRN  10010101100011001
NAM  Q9CEL3_LACLA/138-203
ASQ  GQHLLKRKLTYQYV------GFVQVETK-DSLAIEEAKYPLKAEDNFS---QIYASNEFISDQMKVSFNQGMVIVI
DSQ  GGTCAGCATTTACTAAAGAGAAAGCTAACTTACCAATATGTT------------------GGATTTGTTCAAGTAGAAACAAAG---GATAGTTTAGCCATTGAAGAAGCAAAATATCCTTTGAAAGCAGAGGATAATTTTAGT---------CAAATCTATGCTAGTAATGAATTTATCAGTGACCAAATGAAAGTTTCATTCAATCAGGGAATGGTCATTGTAATT
TRN  10010101110011000
NAM  Q9A1H7_STRPY/139-203
ASQ  GQHLIHQEEGMTYV------AFMAEGE--ADLTITGAKFELTQDNFFK---KKIYSSNAFIHQPITVSLPSGYLII
DSQ  GGTCAGCACCTTATCCATCAAGAAGAAGGGATGACCTATGTG------------------GCATTTATGGCAGAAGGAGAA------GCTGACTTGACCATTACTGGTGCTAAATTTGAGTTGACGCAAGATAATTTTTTCAAA---------AAGAAAATCTATTCCAGTAATGCCTTTATCCATCAACCTATTACAGTTAGTTTGCCAAGTGGCTACTTGATTATT
TRN  11011101111011011
NAM  Q99UP5_STAAM/140-206
ASQ  GQHTVEKDKSYPYI------SFIPMTDD-VELSLAGFKYNLARQMLNIGS-TLTIS-NEIESLQAKVTVHDGLILQ
DSQ  GGTCAACATACAGTTGAAAAAGATAAGAGTTATCCGTACATT------------------TCATTTATACCGATGACTGATGAT---GTAGAACTTTCTCTAGCAGGTTTTAAATATAATTTAGCTAGACAAATGCTTAATATAGGTTCT---ACTTTAACTATTTCA---AATGAAATTGAGTCTTTGCAAGCGAAAGTAACTGTACATGATGGGTTGATTTTGCAA
TRN  10010101110011000
//