EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04054 - Not1)
FAM  PF04054
PID  Not1
DES  CCR4-Not complex component, Not1
IPR  IPR007196
ANO  6
ALN  415
AID  0.432586
APH  (((Q9BVZ6_HUMAN/159-539:0.15172,Q9V591_DROME/1779-2160:0.20685):0.07291,O81909_ARATH/1466-1860:0.53743):0.14012,(P87112_SCHPO/1718-2095:0.79703,NOT1_YEAST/1698-2098:1.04001):0.20466,Q20937_CAEEL/2092-2481:0.42213);
ATP  (((Q9BVZ6_HUMAN/159-539,Q9V591_DROME/1779-2160),O81909_ARATH/1466-1860),(P87112_SCHPO/1718-2095,NOT1_YEAST/1698-2098),Q20937_CAEEL/2092-2481);
ATL  3.57286
DNO  6
DLN  1245
DID  0.491122
DPH  (Q9BVZ6_HUMAN/159-539:0.17912,Q9V591_DROME/1779-2160:0.29602,(((NOT1_YEAST/1698-2098:0.62113,P87112_SCHPO/1718-2095:0.52099):0.14310,Q20937_CAEEL/2092-2481:0.40531):0.11141,O81909_ARATH/1466-1860:0.40128):0.08072);
DTP  (Q9BVZ6_HUMAN/159-539,Q9V591_DROME/1779-2160,(((NOT1_YEAST/1698-2098,P87112_SCHPO/1718-2095),Q20937_CAEEL/2092-2481),O81909_ARATH/1466-1860));
DTL  2.75908
RID  0.432586
RPH  (((Q9BVZ6_HUMAN/159-539:0.15172,Q9V591_DROME/1779-2160:0.20685):0.07291,O81909_ARATH/1466-1860:0.53743):0.14012,(P87112_SCHPO/1718-2095:0.79703,NOT1_YEAST/1698-2098:1.04001):0.20466,Q20937_CAEEL/2092-2481:0.42213);
RTP  (((Q9BVZ6_HUMAN/159-539,Q9V591_DROME/1779-2160),O81909_ARATH/1466-1860),(P87112_SCHPO/1718-2095,NOT1_YEAST/1698-2098),Q20937_CAEEL/2092-2481);
RTL  3.57286
LNK  NOT1_YEAST/1698-2098:P25655:X70151
LNK  O81909_ARATH/1466-1860:O81909:U89959
LNK  P87112_SCHPO/1718-2095:P87112:Z95334
LNK  Q20937_CAEEL/2092-2481:Q20937:U13876
LNK  Q9BVZ6_HUMAN/159-539:Q9BVZ6:BC000779
LNK  Q9V591_DROME/1779-2160:Q9V591:AE003833
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q20937_CAEEL/2092-2481
ASQ  SLFNEIT---GPDPLKLLEPI----AWSILEAFGQTF----FALQPRRM-PGFAFAWLDIVGHRNVIGRLLANTGIAETVDAVKTAATYTQLIISHLKFLAPFLRNIQLPKSIAILYKGTLRVLLVILHDFPELLCEFHYVICDTIPPNCVQLRNLILSAYPRQMRLPDPFALNFKQVDTIPEMAVEPKSNLNM-ATIIPDNIRIPLDEYLANRIS-VDFLPNLPTLLQTQNQ--A-----GTKYNTTVMNALVLYVGIRAIEHLHLRRQRISTLNIAHTSYMDIFQNLAIQLDTEGRYLLFNGIANQLRYPNAHTHYFSCVFLYLFKNSTND----TIQEQITRILFERLVALRPHPWGLLITFIELIKNPTYNFWRYEFTSCAPEIQRLFQNVANTCVPAQGSQPQAQPDGAP
DSQ  AGCCTGTTCAATGAGATTACT---------GGACCTGATCCATTGAAACTTCTTGAACCAATA------------GCTTGGAGCATTTTGGAGGCTTTCGGACAAACTTTC------------TTTGCTCTCCAACCACGACGAATG---CCTGGATTCGCTTTCGCTTGGCTCGATATTGTCGGACATAGAAACGTGATTGGACGTCTTTTGGCAAACACTGGCATTGCTGAAACCGTCGATGCTGTGAAAACGGCAGCCACTTACACTCAATTGATCATTTCTCATTTGAAGTTCTTGGCTCCATTCCTTCGTAACATTCAATTGCCAAAATCGATTGCCATTCTGTACAAGGGAACACTACGTGTTCTGCTGGTCATACTTCACGATTTCCCGGAGCTTCTTTGCGAATTCCACTATGTAATTTGCGATACGATTCCACCAAATTGTGTGCAACTTCGCAATTTGATATTATCAGCGTATCCACGTCAAATGCGCCTTCCGGACCCATTTGCATTGAACTTCAAACAAGTTGACACAATTCCAGAGATGGCAGTGGAACCGAAGTCCAATTTAAACATG---GCTACAATCATACCAGATAACATTCGAATTCCATTGGATGAATATCTTGCAAATCGTATATCT---GTCGATTTCCTTCCAAACCTGCCGACTCTTTTGCAAACTCAGAATCAA------GCC---------------GGTACCAAATACAACACTACTGTAATGAACGCTCTCGTTTTGTACGTCGGAATCAGAGCTATTGAGCACTTGCACTTGAGACGTCAACGTATCTCAACGCTGAACATAGCTCATACATCGTATATGGACATTTTCCAGAATTTAGCAATTCAATTGGATACCGAAGGACGTTACCTTCTTTTCAACGGAATCGCCAATCAACTTCGTTATCCAAATGCTCATACACACTACTTCAGCTGTGTATTTTTGTATCTCTTCAAGAACTCTACAAATGAC------------ACAATTCAAGAGCAGATCACACGTATTCTGTTCGAGCGTCTTGTAGCTCTCCGACCTCATCCATGGGGACTTCTTATAACGTTCATAGAGCTCATCAAGAATCCAACATACAACTTCTGGCGTTATGAGTTCACCAGTTGTGCACCAGAAATACAGAGATTGTTCCAAAATGTTGCCAACACTTGTGTCCCAGCCCAAGGATCTCAGCCACAAGCACAACCAGATGGTGCCCCA
TRN  10010101100011000
NAM  O81909_ARATH/1466-1860
ASQ  IQQRELSVAHCISSEDINSGAVQSPQQPQSPSFLIIDMFSQLLPTPSTHCSLLRFLLSELVSHRSFMPKLLT-------VNGQKGWPYVQRLLVDLLQFLEPFLRNAELGGPVHFLYKGTLRVLLVLLHDFPEFLCDYHFTFCDVIPSSCIQMRNIILSSFPRNMRLPDPSTPNLK-IDLLPEIVEAPCILSEVDAALKAKQMKNDVDEYLTSRQQNSTFLSELKTKLLLSSS--E-ASSAGTRYSVPLINSLVLYTGMQAIQQLQA-----GETQAQNVVALQMFKYLSMELDTEGRYLFLNAIANQLRYPNNHTHYFSFIMLYLFFESDQE----IIQEQITRVLLERLIVNRPHPWGLLITFIELIKNPRYSFWKQAFIRCAPEIEKLFESVARSCGGLKPVDEGMVSGGWV
DSQ  ATACAACAGAGAGAACTTTCTGTTGCTCATTGTATATCTTCTGAAGATATTAATTCCGGTGCTGTGCAATCTCCTCAGCAACCTCAGAGTCCATCATTCCTTATCATTGATATGTTCTCACAGCTTTTGCCAACGCCTTCCACGCATTGCAGCCTCTTAAGATTCCTGCTTTCAGAACTTGTCAGCCACAGAAGCTTCATGCCCAAACTACTTACA---------------------GTAAATGGCCAGAAGGGTTGGCCATATGTTCAGCGCCTGCTGGTGGACTTGCTTCAGTTTCTTGAGCCATTTTTAAGAAATGCTGAACTCGGAGGACCGGTTCATTTCCTATACAAAGGGACATTGAGAGTATTACTGGTTCTGCTTCATGATTTCCCAGAGTTCCTATGTGATTATCATTTTACTTTCTGTGATGTGATTCCTTCAAGTTGCATACAAATGCGGAATATTATCCTCAGTTCTTTTCCACGGAACATGAGGCTTCCTGATCCTTCTACCCCAAATTTAAAG---ATTGATTTGTTACCTGAGATAGTAGAAGCTCCCTGTATCCTTTCTGAGGTTGATGCTGCGCTAAAGGCAAAGCAAATGAAGAATGACGTGGATGAGTATCTTACGTCGAGGCAGCAAAATTCAACTTTCCTAAGTGAGTTGAAGACAAAGTTACTTCTATCGTCCAGC------GAG---GCTAGTTCAGCTGGAACCCGTTACAGTGTACCATTGATCAACTCGCTTGTGCTATATACTGGAATGCAGGCTATTCAGCAGCTTCAGGCC---------------GGTGAGACACAGGCTCAAAATGTTGTGGCCTTGCAGATGTTCAAGTATTTAAGTATGGAACTTGATACGGAAGGGCGGTATCTGTTCCTTAATGCAATCGCCAATCAGCTTCGATACCCCAACAACCACACTCATTACTTTTCTTTCATCATGCTCTATCTATTCTTCGAATCTGATCAGGAG------------ATCATACAGGAGCAAATAACTAGAGTGCTGTTGGAACGGCTAATTGTGAACAGGCCACATCCATGGGGACTTCTAATCACATTCATTGAGCTAATAAAGAACCCAAGATATAGCTTCTGGAAACAAGCCTTCATCAGATGTGCGCCTGAGATTGAGAAGCTGTTTGAATCGGTAGCCAGATCCTGTGGTGGCCTGAAGCCTGTCGACGAGGGAATGGTTTCGGGAGGTTGGGTC
TRN  10010101100011000
NAM  Q9BVZ6_HUMAN/159-539
ASQ  MLLLELN-----APEHVLETI----NFQTLTAFCNTF----HILRPTKA-PGFVYAWLELISHRIFIARMLAH------TPQQKGWPMYAQLLIDLFKYLAPFLRNVELTKPMQILYKGTLRVLLVLLHDFPEFLCDYHYGFCDVIPPNCIQLRNLILSAFPRNMRLPDPFTPNLK-VDMLSEINIAPRILTNF-TGVMPPQFKKDLDSYLKTRSP-VTFLSDLRSNLQVSNE--P-----GNRYNLQLINALVLYVGTQAIAHIHNKGSTPSMSTITHSAHMDIFQNLAVDLDTEGRYLFLNAIANQLRYPNSHTHYFSCTMLYLFAEANTE----AIQEQITRVLLERLIVNRPHPWGLLITFIELIKNPAFKFWNHEFVHCAPEIEKLFQSVAQCCMGQKQAQQVMEGTGAS
DSQ  ATGCTTCTCTTGGAACTCAAT---------------GCACCTGAGCATGTGTTGGAAACCATT------------AATTTCCAGACACTTACAGCTTTCTGCAATACATTC------------CACATCTTGAGGCCTACCAAAGCT---CCTGGCTTTGTATATGCCTGGCTTGAACTGATTTCCCATCGGATATTTATTGCAAGAATGCTGGCACAT------------------ACGCCACAGCAGAAGGGGTGGCCTATGTATGCACAGCTACTGATTGATTTATTCAAATATTTAGCGCCTTTCCTTAGAAATGTGGAACTCACCAAACCTATGCAAATCCTCTACAAGGGCACTTTAAGAGTGCTGCTGGTTCTTTTGCATGATTTCCCAGAGTTCCTTTGTGATTACCATTATGGGTTCTGTGATGTGATCCCACCTAATTGTATCCAGTTAAGAAATTTGATCCTGAGTGCCTTTCCAAGAAACATGAGGCTCCCCGACCCATTCACTCCTAATCTAAAG---GTGGACATGTTGAGTGAAATTAACATTGCTCCCCGGATTCTCACCAATTTC---ACTGGAGTAATGCCACCTCAGTTCAAAAAGGATTTGGATTCCTATCTTAAAACTCGATCACCA---GTCACTTTCCTGTCTGATCTGCGCAGCAACCTACAGGTATCCAATGAA------CCT---------------GGGAATCGCTACAACCTCCAGCTCATCAATGCACTGGTGCTCTATGTCGGGACTCAGGCCATTGCGCACATCCACAACAAGGGCAGCACACCTTCAATGAGCACCATCACTCACTCAGCACACATGGATATCTTCCAGAATTTGGCTGTGGACTTGGACACTGAGGGTCGCTATCTCTTTTTGAATGCAATTGCAAATCAGCTCCGGTACCCAAATAGCCACACTCACTACTTCAGTTGCACCATGCTGTACCTTTTTGCAGAGGCCAATACGGAA------------GCCATCCAAGAACAGATCACAAGAGTTCTCTTGGAACGGTTGATTGTAAATAGGCCACATCCTTGGGGTCTTCTTATTACCTTCATTGAGCTGATTAAAAACCCAGCGTTTAAGTTCTGGAACCATGAATTTGTACACTGTGCCCCAGAAATCGAAAAGTTATTCCAGTCGGTCGCACAGTGCTGCATGGGACAGAAGCAGGCCCAGCAAGTAATGGAAGGGACAGGTGCCAGT
TRN  10010101100011000
NAM  Q9V591_DROME/1779-2160
ASQ  MLFMELC-----TADVILESL----MHSIVSAFAYTY----HLLNPSVA-PGFCFAWLELISHRVFLGRILVQ------IPGQKGWPLYAQLLQDLFKYLAPFLRNTELGKPVQLLYKGTLRVLLVLLHDFPEFLCDYHFGFCDTIPPNCVQMRNIILSAFPRNMRLPDPFTPNLK-VDMLSDSSNAPKVLSSYIMNIQPANFKKDLDSYLKARAP-VTFLSELRGHLQVTSE--P-----GTRYNMALMNALVMYVGTQAIALIRNKNFVPNTSNIAHSAHMDIFQNLAVDLDTEGRYLFLNAIANQLRYPNSHTHYFSCAVLHLFAEANSE----AIQEQITRVLLERLIVNRPHPWGLLITFIELIKNPIYKFWDHDFVHCAPEITKLFESVARSCLAKSNVTQQLNMPVVD
DSQ  ATGCTGTTCATGGAGCTGTGC---------------ACGGCCGATGTGATTCTCGAGTCCCTG------------ATGCACAGTATTGTGTCGGCCTTCGCCTACACATAT------------CACTTGTTGAATCCCAGCGTGGCT---CCGGGATTCTGCTTTGCTTGGTTGGAGCTCATTTCGCATCGCGTCTTCCTGGGCCGCATCCTGGTCCAA------------------ATTCCCGGGCAAAAGGGCTGGCCACTTTACGCTCAGTTGCTGCAGGACCTTTTTAAATATCTTGCGCCCTTCTTACGCAACACTGAGCTCGGCAAACCAGTCCAGCTTTTGTACAAGGGGACGCTACGTGTTCTGCTCGTTCTGCTTCACGACTTCCCGGAGTTCTTGTGCGACTATCATTTTGGGTTCTGTGACACCATCCCGCCCAATTGCGTCCAGATGCGTAACATCATCCTGTCGGCGTTTCCGCGCAACATGCGCTTGCCCGATCCCTTCACGCCCAACCTAAAA---GTGGACATGCTGTCGGACAGTAGTAATGCGCCTAAGGTGCTCAGTAGCTACATTATGAACATCCAGCCCGCGAACTTTAAGAAGGATTTGGACTCGTACCTCAAGGCCCGGGCGCCA---GTTACTTTTCTATCGGAATTACGTGGTCACTTGCAGGTGACAAGCGAG------CCA---------------GGAACTCGTTACAACATGGCACTGATGAATGCTCTGGTCATGTATGTGGGAACTCAGGCGATTGCTTTGATCAGAAACAAAAACTTTGTGCCCAACACCTCGAACATAGCACACAGCGCCCACATGGATATCTTCCAGAATCTTGCTGTTGACTTGGATACGGAGGGTCGCTATCTGTTCTTGAATGCGATTGCGAACCAGTTGCGCTATCCCAACAGCCACACGCACTACTTCAGCTGTGCGGTGCTGCATCTGTTTGCCGAGGCCAACTCGGAG------------GCAATTCAGGAGCAGATCACTCGCGTACTTCTGGAACGATTGATCGTGAACCGCCCGCATCCTTGGGGACTGTTGATCACTTTTATTGAGCTGATCAAAAATCCCATCTACAAGTTCTGGGACCATGACTTTGTGCACTGTGCGCCAGAGATCACCAAGCTCTTTGAATCGGTGGCCCGTTCCTGTCTGGCCAAGTCGAACGTCACCCAGCAGTTGAACATGCCCGTCGTCGAT
TRN  10010101100011010
NAM  P87112_SCHPO/1718-2095
ASQ  SILSELD-----DAKDVLESC----FVDIYSVILECF----LAIQPRSF-PAFTFAWLSLISHSYLLPKVLL-------VNNDKINDLFSEILMSFLKFLD--LKDDIDKAQFKLLYNGFLRIILVLLHDFPGFLATHCYQLIPYIPLECVQLRNMVLSAFPSDLHLPDPFAQGLK-VGRLPEVTRAPLISNSVSASLEKFASALDLEACFSSSKP-AE-VAKLLLEVYSSQD-------TPTKLNEW-ANYFMLCLIRHATRDSPAKQAPQFQ---SKSPECVIISTMNRSCDSKCRYFLLTAIANQLRYPSSHTYYASCCFLYLFKSSSNNPQELLIKEQMTTVLLERIICNRPHPWGLLITFTELLKNEDYNFWKHPYIKRNDEICRLFDSLHEHVMAPSSANNVSTEEATE
DSQ  AGTATACTCTCCGAGCTTGAT---------------GATGCTAAGGATGTATTGGAGTCCTGC------------TTCGTCGATATCTATAGTGTTATTTTAGAATGCTTC------------CTTGCTATTCAGCCACGCTCTTTC---CCAGCGTTTACATTTGCCTGGCTTAGCCTTATTTCACATTCATACTTACTACCGAAGGTTCTTCTT---------------------GTCAATAATGATAAAATTAATGATTTATTTAGTGAGATCCTGATGTCCTTTTTAAAATTTTTAGAT------TTGAAGGATGATATTGATAAAGCCCAATTTAAACTTCTTTATAATGGCTTCTTGAGGATCATACTTGTTCTTCTTCATGATTTCCCTGGCTTTTTGGCTACCCATTGTTACCAATTGATACCTTATATTCCATTAGAATGCGTGCAACTTCGTAATATGGTATTGAGCGCGTTTCCTAGTGATCTTCATCTTCCTGATCCATTTGCTCAAGGTTTGAAG---GTAGGCAGATTACCTGAGGTAACCCGCGCACCATTAATTTCAAATTCAGTTTCTGCTTCACTTGAGAAATTTGCGTCAGCGTTGGATTTAGAAGCTTGTTTCTCTTCTTCCAAACCA---GCGGAA---GTTGCCAAGCTATTGTTAGAAGTGTACTCAAGTCAAGAT---------------------ACCCCTACTAAATTAAACGAATGG---GCAAACTATTTTATGCTTTGTTTAATACGCCACGCTACTCGTGATTCCCCTGCCAAGCAAGCCCCACAATTTCAA---------TCAAAATCTCCTGAATGTGTAATTATTAGTACTATGAATCGCAGTTGCGATTCAAAGTGCCGCTATTTCTTGTTAACTGCGATTGCTAATCAGCTGCGTTACCCTAGCAGCCATACTTACTATGCTAGCTGTTGTTTCTTGTACCTTTTCAAGAGTTCTTCTAACAACCCTCAAGAATTGCTTATCAAAGAACAGATGACAACTGTACTTTTGGAACGCATAATTTGCAATCGACCACATCCTTGGGGCCTTTTAATTACATTTACTGAATTATTAAAAAATGAAGACTATAACTTTTGGAAACACCCTTATATAAAGCGAAACGATGAAATCTGTCGTTTGTTTGATAGTCTCCATGAACATGTCATGGCACCCTCCTCAGCTAATAATGTCTCTACCGAAGAGGCTACAGAA
TRN  10010101100011000
NAM  NOT1_YEAST/1698-2098
ASQ  NILYEWATIRTHNFVRISDSSTRQELIEFDSVFYNTFSGYLHALQPFAF-PGFSFAWVTLLSHRMLLPIMLR-------LPNKIGWEKLMLLIIDLFKFLDQYTSKHAVSDAVSVVYKGTLRVILGISNDMPSFLIENHYELMNNLPPTYFQLKNVILSAIPKNMTVPNPYDVDLN-MEDIPACKELPEVFFDPVIDL--HSLKKPVDNYLRI-PSNSLLRTILSAIYKDTYDIKKGVGYDFLSVDSKLIRAIVLHVGIEA--GIEYKRTSSNAVFNTKSSYYTLLFNLIQNGSIEMKYQIILSIVEQLRYPNIHTYWFSFVLMNMFKSDEWNDQKLEVQEIILRNFLKRIIVNKPHTWGVSVFFTQLINNNDINLLDLPFVQSVPEIKLILQQLVKYSKKYTTSEQDDQSATIN
DSQ  AACATCTTATACGAATGGGCTACCATCAGGACGCACAATTTTGTTAGAATATCTGATTCCAGCACTAGGCAGGAGCTGATCGAATTTGATTCTGTATTTTACAACACTTTCTCAGGATATTTGCACGCTCTGCAACCATTTGCCTTC---CCTGGATTCTCATTTGCATGGGTGACACTATTATCACACAGAATGTTATTACCAATTATGCTAAGA---------------------TTACCCAATAAAATAGGTTGGGAAAAGTTAATGCTTTTGATTATCGATTTGTTTAAATTTTTGGACCAATACACAAGTAAACATGCAGTCTCTGACGCTGTTTCGGTTGTTTATAAGGGAACACTGCGTGTTATTTTAGGCATTTCGAATGATATGCCATCCTTTTTGATTGAAAATCACTATGAATTAATGAACAATCTACCTCCAACATATTTCCAACTAAAGAATGTTATTTTATCTGCTATTCCTAAGAATATGACCGTTCCCAACCCATATGACGTGGATCTTAAT---ATGGAGGATATTCCAGCATGTAAAGAACTACCTGAAGTCTTCTTTGATCCTGTAATTGATTTA------CACTCATTGAAAAAGCCAGTTGACAACTACCTACGTATT---CCCTCAAATTCATTATTAAGAACAATACTAAGCGCTATTTACAAGGATACCTATGACATAAAAAAGGGCGTAGGCTACGACTTTTTATCTGTTGATAGTAAATTAATTCGCGCTATTGTATTACATGTGGGCATTGAAGCT------GGAATAGAGTATAAGAGAACTTCTTCAAATGCGGTATTTAATACGAAGTCTTCTTATTATACTTTATTGTTCAATCTGATTCAAAATGGTAGCATCGAAATGAAATATCAAATTATTCTGTCTATTGTGGAACAATTGCGGTATCCAAACATCCACACCTATTGGTTCAGCTTTGTGTTAATGAATATGTTCAAAAGTGACGAATGGAATGATCAAAAACTTGAAGTCCAAGAAATTATTTTAAGAAACTTTTTAAAAAGAATTATTGTTAACAAACCACATACCTGGGGTGTTTCAGTTTTCTTTACTCAGTTGATAAACAATAACGATATTAATCTTTTAGACCTGCCCTTTGTACAAAGTGTTCCCGAAATTAAACTAATTTTACAACAATTAGTAAAATATTCCAAAAAATACACAACCAGTGAACAAGATGACCAATCCGCCACCATCAAT
TRN  10010101100011000
//