EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03932 - CutC)
FAM  PF03932
PID  CutC
DES  CutC family
IPR  IPR005627
ANO  8
ALN  211
AID  0.417362
APH  (CUTC_SHIFL/2-201:0.48330,((CUTC_CAUCR/6-206:0.54843,((CUTC_PASMU/1-202:0.35814,(Q9A184_STRPY/1-209:0.33335,Q9CE53_LACLA/2-206:0.31477):0.65479):0.07651,CUTC_VIBCH/3-206:0.37122):0.08991):0.10125,CUTC_RHILO/14-215:0.53211):0.08329,CUTC_XYLFA/26-227:0.49162);
ATP  (CUTC_SHIFL/2-201,((CUTC_CAUCR/6-206,((CUTC_PASMU/1-202,(Q9A184_STRPY/1-209,Q9CE53_LACLA/2-206)),CUTC_VIBCH/3-206)),CUTC_RHILO/14-215),CUTC_XYLFA/26-227);
ATL  4.43869
DNO  7
DLN  633
DID  0.474563
DPH  (CUTC_XYLFA/26-227:0.45269,(CUTC_RHILO/14-215:0.38829,CUTC_CAUCR/6-206:0.34134):0.13976,(CUTC_VIBCH/3-206:0.38165,((Q9CE53_LACLA/2-206:0.31013,Q9A184_STRPY/1-209:0.27523):0.37204,CUTC_PASMU/1-202:0.29146):0.08919):0.11502);
DTP  (CUTC_XYLFA/26-227,(CUTC_RHILO/14-215,CUTC_CAUCR/6-206),(CUTC_VIBCH/3-206,((Q9CE53_LACLA/2-206,Q9A184_STRPY/1-209),CUTC_PASMU/1-202)));
DTL  3.1568
RID  0.418577
RPH  (((CUTC_XYLFA/26-227:0.59949,(CUTC_VIBCH/3-206:0.37111,(CUTC_PASMU/1-202:0.34729,CUTC_RHILO/14-215:0.58028):0.10208):0.08034):0.05113,CUTC_CAUCR/6-206:0.48559):0.65635,Q9CE53_LACLA/2-206:0.28196,Q9A184_STRPY/1-209:0.36831);
RTP  (((CUTC_XYLFA/26-227,(CUTC_VIBCH/3-206,(CUTC_PASMU/1-202,CUTC_RHILO/14-215))),CUTC_CAUCR/6-206),Q9CE53_LACLA/2-206,Q9A184_STRPY/1-209);
RTL  3.92934
LNK  CUTC_CAUCR/6-206:Q9A5T7:AE005905
LNK  CUTC_PASMU/1-202:Q9CNA6:AE006088
LNK  CUTC_RHILO/14-215:Q98L96:AP002996
LNK  CUTC_SHIFL/2-201:P67825:
LNK  CUTC_VIBCH/3-206:Q9KU00:AE004159
LNK  CUTC_XYLFA/26-227:Q9PDN8:AE003966
LNK  Q9A184_STRPY/1-209:Q9A184:AE006502
LNK  Q9CE53_LACLA/2-206:Q9CE53:AE006429
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  CUTC_XYLFA/26-227
ASQ  AGLEVAAGSVASALAAQEGGAMRVELCHGLGGGGLTPSYGMLAVVRE---RLHIPLYVLIRPRGGDFVFSEEEMEVMCCDVECCVRLGCDGVVLGALDPAGEVDMGMMRVLIAVAG--SLGVTFHRAIDVSAD--PGRTLEDVIALGCERVLTSGGR--SSALEGAETIAALVAQAAGRVVVMPGAGVSAGNVLELRVRTGAHEFHASARS
DSQ  GCTGGACTGGAGGTGGCTGCTGGCTCGGTTGCGTCGGCGCTGGCCGCGCAGGAGGGCGGGGCCATGCGGGTGGAGTTGTGTCATGGGTTGGGGGGGGGCGGGTTGACTCCGTCGTATGGGATGTTGGCTGTGGTGCGTGAG---------CGTTTGCATATCCCGCTTTATGTGTTGATCCGGCCTCGGGGCGGCGATTTTGTGTTTTCCGAGGAGGAAATGGAGGTGATGTGCTGTGATGTGGAGTGTTGCGTGCGTCTTGGTTGTGATGGGGTGGTGCTTGGTGCATTGGATCCGGCCGGTGAGGTTGATATGGGGATGATGCGGGTGTTGATTGCCGTGGCTGGG------TCGCTTGGTGTGACTTTTCATCGTGCGATTGATGTCAGTGCGGAT------CCAGGACGTACGTTGGAGGATGTGATTGCGCTGGGCTGTGAGCGGGTGTTGACTTCAGGGGGGCGT------TCGAGCGCGCTGGAGGGTGCTGAGACTATTGCGGCGTTGGTGGCTCAGGCAGCAGGGCGGGTTGTGGTGATGCCAGGTGCGGGTGTGTCTGCAGGGAATGTCCTGGAGTTGCGGGTTCGCACGGGAGCGCATGAGTTCCATGCGTCGGCGCGCAGT
TRN  11011111101111101
NAM  CUTC_SHIFL/2-201
ASQ  ALLEICCYSMECALTAQQNGADRVELCAAPKEGGLTPSLGVLKSVRQ---RVTIPVHPIIRPRGGDFCYSDGEFAAILEDVRTVRELGFPGLVTGVLDVDGNVDMPRMEKIMAAAG--PLAVTFHRAFDMCAN--PLYTLNNLAELGIARVLTSGQK--SDALQGLSKIMELIAHRDAPI-IMAGAGVRAENLHHFLD-AGVLEVHSSAGA
NAM  CUTC_CAUCR/6-206
ASQ  VLLEVCVDTPAGLAAAIAGGADRVELCSALALQGLTPAPGLMAQAA----SAPIPVYPMIRPRHGDFCYDARDLDAMRRDIDAVRGYGLPGVTIGASQANGALDLKVLRKLVEQAE--GLGTTLHRAFDVVPD--MSEALEIAVELGFERVLTSGGA--LSALDATDRLAALVEQAGERISIMAGAGVRPGNIAELVRRTGVREAHGSFGG
DSQ  GTTCTGCTGGAAGTCTGCGTCGATACGCCCGCTGGATTGGCGGCGGCGATCGCCGGTGGCGCGGATCGCGTCGAACTCTGCTCGGCGCTCGCCCTGCAAGGCCTGACCCCAGCGCCCGGCCTGATGGCGCAGGCCGCG------------TCGGCGCCGATCCCGGTTTATCCGATGATCCGCCCGCGCCACGGCGACTTCTGCTACGACGCGCGCGACCTGGATGCGATGCGGCGGGATATCGACGCGGTTCGAGGCTACGGCCTGCCCGGCGTCACGATCGGCGCGAGCCAGGCCAACGGCGCCTTGGATCTAAAGGTCCTGCGCAAGCTGGTGGAACAGGCTGAG------GGCCTGGGCACGACGCTGCATCGCGCTTTCGACGTGGTTCCAGAC------ATGTCCGAAGCGCTTGAGATCGCTGTCGAGCTGGGCTTCGAGCGCGTGCTGACCTCGGGCGGCGCG------CTGAGCGCGCTGGACGCGACAGACAGGCTCGCCGCATTGGTGGAACAGGCGGGCGAGCGTATCAGCATCATGGCTGGAGCGGGCGTCAGGCCCGGCAACATCGCCGAACTGGTGCGCCGGACGGGCGTGCGGGAGGCGCATGGCTCGTTCGGCGGT
TRN  10010101100011011
NAM  CUTC_PASMU/1-202
ASQ  MKIEVCIDNIESVHIAQNAGADRLELCACLSVGGVTPSYSLIKSAVD---FANIPCYVMIRPRAGDFLFSTQEVNMMLDDIHLAKQLGAQGIVIGALTKHADIDLSVCETLIQAAE--GLGVTFHRAFDLCRD--PVTSLEQLIQLGCERVLTSGQK--ASAVEGQPLIKQLVSQASNRIRIMAGAGINAQNAALLVKNTGITELHLSGKG
DSQ  ATGAAAATCGAAGTCTGTATTGATAATATTGAATCGGTACACATTGCGCAAAATGCTGGCGCCGATCGTTTAGAACTTTGTGCTTGCCTCTCCGTTGGCGGCGTTACGCCCTCCTATTCGTTGATAAAAAGTGCGGTCGAT---------TTTGCTAACATTCCTTGTTATGTCATGATCCGACCAAGAGCAGGAGATTTTTTGTTCAGTACGCAAGAAGTCAACATGATGCTCGATGATATTCACCTTGCTAAACAGCTCGGCGCTCAAGGCATTGTGATCGGTGCATTGACCAAACATGCTGACATTGACCTTTCGGTTTGCGAAACATTAATACAGGCAGCAGAA------GGATTGGGCGTCACTTTTCATCGTGCCTTTGATCTCTGTCGCGAT------CCCGTCACGAGCTTAGAACAATTAATTCAGTTAGGTTGCGAACGCGTATTGACTTCTGGACAAAAA------GCCAGCGCAGTAGAAGGACAACCGTTAATCAAACAGCTTGTCAGTCAGGCATCAAACCGTATTCGTATTATGGCTGGTGCCGGCATCAATGCACAAAATGCCGCCTTATTAGTGAAAAATACGGGAATTACCGAATTGCATTTATCTGGAAAAGGT
TRN  10010101110011000
NAM  CUTC_VIBCH/3-206
ASQ  YQVEVCIDNIESLHNAIAGGATRIELCSSLALGGLTPSAGLMYSAGR---VSPIPAYAMIRPREGDFFYHDDELSIMAQDIRTAHQANLQGVVLGLLNADGTIDVKRSKPLIELAHSLGLGVTFHRAFDHCVN--PEHALEEIIALGCERILTSGLA--RNAYLGIERLAQLVKQSAGRISIMAGAGINAQNVAEIALATGVNELHLSAKT
DSQ  TATCAAGTTGAAGTCTGTATCGACAATATCGAATCCCTGCATAACGCCATCGCGGGAGGCGCAACCCGTATTGAGCTTTGTTCATCCCTTGCGCTAGGTGGATTAACCCCTAGTGCCGGGTTGATGTACAGCGCAGGCAGA---------GTGTCACCGATTCCGGCTTACGCAATGATCAGACCAAGAGAAGGGGATTTTTTCTATCACGATGATGAACTCAGCATTATGGCGCAGGACATTCGTACGGCGCATCAAGCAAACTTACAAGGCGTGGTACTAGGGTTACTCAATGCCGATGGCACGATTGATGTGAAACGCAGCAAACCTTTAATCGAACTTGCTCACTCCCTCGGGTTAGGTGTGACGTTTCACCGCGCATTTGACCACTGTGTAAAC------CCTGAACACGCGTTAGAAGAGATCATTGCGCTCGGTTGTGAACGCATTTTGACCTCAGGCTTGGCG------CGCAACGCTTATCTGGGTATTGAACGTTTAGCGCAACTGGTCAAACAGAGTGCTGGGCGCATTTCAATCATGGCAGGCGCTGGGATCAATGCGCAGAATGTGGCTGAAATTGCGTTAGCCACCGGGGTCAATGAGCTGCATTTATCCGCGAAAACC
TRN  10010101100011000
NAM  CUTC_RHILO/14-215
ASQ  PLIEICVEGIDGLLAAQAAGADRVELCASLVEGGITPSLGTVRAALD---QATVPFHVMVRPRGGDFLYSETEYRSMLADVAALRDLGVPGVVFGCLNADGTIDEKRMGELTEAAG--PLNVTCHRAFDMTRD--PAEALEALIRCKVGRVLTSGQR--DSAIEGLPLLADLVRQAGDRIIILGCGGLDLANIAEVRRKTGLAEMHFAALK
DSQ  CCCCTGATCGAAATCTGTGTAGAAGGCATCGATGGCCTGCTCGCCGCGCAGGCTGCCGGCGCCGACCGGGTCGAACTGTGCGCCAGCCTCGTCGAGGGCGGCATCACACCGAGCCTCGGCACGGTGCGCGCCGCTCTCGAC---------CAGGCGACCGTGCCGTTTCACGTCATGGTGCGGCCGCGCGGCGGCGATTTTCTCTACAGCGAGACCGAATACCGCTCGATGCTCGCCGATGTCGCGGCACTGCGCGATCTCGGCGTGCCCGGCGTGGTGTTTGGCTGCCTGAACGCCGACGGCACCATCGACGAGAAGCGCATGGGCGAACTGACGGAGGCCGCCGGC------CCCCTGAACGTCACTTGCCATCGCGCCTTCGACATGACACGCGAC------CCGGCCGAGGCGCTGGAGGCGCTGATCCGCTGCAAGGTCGGCCGCGTGCTGACCAGCGGCCAACGC------GACAGCGCGATCGAAGGCCTGCCCTTGCTGGCCGATCTGGTGCGGCAGGCCGGCGACCGCATCATCATCCTCGGTTGCGGCGGGCTTGATCTCGCAAACATCGCCGAGGTGCGCCGAAAGACCGGGCTGGCCGAAATGCATTTTGCCGCGCTGAAG
TRN  11011111101111111
NAM  Q9A184_STRPY/1-209
ASQ  MIKEFCAENLTLLPTLDAGQISRVELCDNLAVGGTTPSYGVIKEACQLLHDKKISVATMIRPRGGDFVYNDLELKAMEEDILKAVEAGSDALVLGLLTTENQLDTDAIEQLLPATQ--GLPLVFHMAFDRIPTDHQHQALDQLIDYGFVRVLTHGSPEATPITDNVEQLKSLVTYANKRIEIMIGGGITAENCQSLSQLTGTAIVHGTKII
DSQ  ATGATTAAAGAATTTTGTGCTGAGAACCTCACACTACTGCCAACCCTTGATGCTGGTCAAATCAGTCGTGTGGAACTCTGTGATAACCTAGCTGTCGGAGGGACCACGCCATCTTATGGCGTCATCAAAGAAGCCTGTCAGCTCTTACACGATAAAAAGATTAGCGTAGCGACCATGATTCGACCTCGCGGTGGCGATTTTGTCTATAACGACCTCGAACTAAAAGCTATGGAAGAAGATATCTTAAAAGCTGTTGAAGCTGGCTCAGATGCGCTAGTCTTAGGCTTGCTGACCACAGAAAATCAACTGGATACCGACGCTATCGAGCAATTACTGCCTGCTACACAA------GGCTTGCCACTGGTTTTCCACATGGCTTTTGACCGGATTCCGACTGATCACCAGCACCAAGCGCTTGACCAACTGATTGATTATGGCTTTGTGCGTGTGCTAACTCATGGCTCACCTGAAGCTACTCCTATTACAGACAATGTGGAACAGCTTAAAAGTCTTGTGACCTATGCCAATAAACGCATTGAAATCATGATTGGGGGAGGCATCACTGCTGAGAATTGCCAAAGCTTGAGTCAACTCACTGGAACGGCCATTGTTCACGGGACTAAAATCATT
TRN  11011101101011000
NAM  Q9CE53_LACLA/2-206
ASQ  IIRELCLENFTKIPQALQAGVERIELCDNLAVGGTTPSYGVIEEAAKYVAESKTTLAVMIRPRGGNFVYNSHELKIIETDTLKAVEAGAQNIVFGALTPGNEIDTDALETVSIAAQ--GLPITFHMAFDEVTD--QEKAIDQLVEFGVDKILTHGGP--LDQSLNTDKLKSLIDYAKGKINIIIGGGVNAENFENLAQLTGTNYVHGTKII
DSQ  ATTATCCGAGAACTTTGCCTTGAAAATTTTACCAAAATTCCTCAAGCGCTTCAAGCCGGCGTTGAGAGAATTGAACTTTGTGACAACCTCGCCGTTGGAGGAACCACTCCTTCTTATGGTGTTATTGAAGAAGCTGCCAAATATGTTGCCGAAAGTAAGACAACTCTTGCTGTCATGATTCGTCCTCGCGGTGGTAATTTTGTTTATAATTCTCATGAACTTAAAATTATTGAAACTGACACCCTTAAAGCTGTTGAAGCTGGTGCCCAAAACATTGTATTTGGTGCCCTTACTCCTGGCAATGAAATAGATACTGACGCACTTGAAACAGTGAGTATTGCCGCACAA------GGGCTCCCAATCACTTTCCACATGGCTTTTGATGAAGTCACTGAT------CAAGAAAAAGCAATTGACCAACTTGTCGAATTTGGCGTAGATAAAATTTTGACGCACGGTGGGCCA------CTTGACCAATCCTTAAATACTGACAAACTTAAAAGTCTCATTGACTATGCTAAGGGTAAAATTAACATTATTATTGGTGGGGGTGTCAATGCTGAAAACTTTGAAAACCTCGCTCAATTAACCGGAACAAATTATGTTCATGGCACAAAAATTATC
TRN  10010101110011010
//