EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03908 - Sec20)
FAM  PF03908
PID  Sec20
DES  Sec20
IPR  IPR005606
ANO  6
ALN  92
AID  0.252052
APH  ((((Q9VNI9_DROME/135-226:0.63068,NIP1_HUMAN/176-267:0.30178):0.81372,Q9LK13_ARATH/183-274:0.51629):0.26146,O42852_SCHPO/122-213:0.81648):0.82768,Q9P887_CANAL/148-239:0.21659,SEC20_YEAST/204-295:0.88214);
ATP  ((((Q9VNI9_DROME/135-226,NIP1_HUMAN/176-267),Q9LK13_ARATH/183-274),O42852_SCHPO/122-213),Q9P887_CANAL/148-239,SEC20_YEAST/204-295);
ATL  5.2668
DNO  6
DLN  276
DID  0.394928
DPH  (Q9VNI9_DROME/135-226:0.44111,(Q9LK13_ARATH/183-274:0.41908,(O42852_SCHPO/122-213:0.47121,(SEC20_YEAST/204-295:0.43808,Q9P887_CANAL/148-239:0.40840):0.41275):0.31444):0.32383,NIP1_HUMAN/176-267:0.30831);
DTP  (Q9VNI9_DROME/135-226,(Q9LK13_ARATH/183-274,(O42852_SCHPO/122-213,(SEC20_YEAST/204-295,Q9P887_CANAL/148-239))),NIP1_HUMAN/176-267);
DTL  3.53721
RID  0.252052
RPH  ((((Q9VNI9_DROME/135-226:0.63068,NIP1_HUMAN/176-267:0.30178):0.81372,Q9LK13_ARATH/183-274:0.51629):0.26146,O42852_SCHPO/122-213:0.81648):0.82768,Q9P887_CANAL/148-239:0.21659,SEC20_YEAST/204-295:0.88214);
RTP  ((((Q9VNI9_DROME/135-226,NIP1_HUMAN/176-267),Q9LK13_ARATH/183-274),O42852_SCHPO/122-213),Q9P887_CANAL/148-239,SEC20_YEAST/204-295);
RTL  5.2668
LNK  NIP1_HUMAN/176-267:Q12981:AF083957
LNK  O42852_SCHPO/122-213:O42852:AL021813
LNK  Q9LK13_ARATH/183-274:Q9LK13:AP000382
LNK  Q9P887_CANAL/148-239:Q9P887:AJ272499
LNK  Q9VNI9_DROME/135-226:Q9VNI9:AE003601
LNK  SEC20_YEAST/204-295:P28791:X60215
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  NIP1_HUMAN/176-267
ASQ  QTSSTITESLMGISRMMAQQVQQSEEAMQSLVTSSRTILDANEEFKSMSGTIQLGRKLITKYNRRELTDKLLIFLALRLFLATVLYIVKKRL
DSQ  CAGACATCCAGTACCATCACTGAGAGCCTCATGGGGATCAGCAGGATGATGGCCCAGCAGGTCCAGCAGAGCGAGGAGGCCATGCAGTCTCTAGTCACTTCTTCACGAACGATCCTGGATGCAAATGAAGAATTTAAGTCCATGTCGGGCACCATCCAGCTGGGCCGGAAGCTTATCACAAAATACAATCGCCGGGAGCTGACGGACAAGCTTCTCATCTTCCTTGCGCTACGCCTGTTTCTTGCTACGGTCCTCTATATTGTGAAAAAGCGGCTC
TRN  10010101100011001
NAM  Q9VNI9_DROME/135-226
ASQ  SQENDVTEKMLAISRHLSETTQKSAITLETLVASSQNVEATSDELHHTAGSISMSGKLLKKYGRRECTDKMLLFFAFSLFLACVFYIVQKRL
DSQ  TCGCAGGAGAACGACGTGACCGAGAAGATGCTGGCTATATCGCGGCACCTCTCGGAGACCACCCAGAAGAGCGCCATCACCCTGGAAACGCTCGTGGCCTCGTCGCAAAATGTGGAGGCCACCAGCGACGAACTGCACCACACGGCCGGCAGCATTAGCATGTCCGGCAAGCTGCTCAAAAAGTACGGACGACGCGAGTGCACTGACAAAATGCTGCTCTTCTTCGCCTTCTCCTTGTTCCTCGCCTGTGTCTTTTACATCGTCCAAAAGCGACTC
TRN  10010101100011011
NAM  Q9LK13_ARATH/183-274
ASQ  SDAESITESLRRSRQLMVQEVERSTNTLVAFDESTGVLKKAESEYKGHRSLLSRTRNLLSTMQRQDVIDRIILIVGFSLFVFAVVYVVSKRI
DSQ  TCCGATGCTGAAAGCATAACTGAAAGTCTCAGGCGTTCACGGCAGCTGATGGTTCAGGAGGTTGAACGAAGTACAAACACTCTCGTGGCTTTTGATGAATCTACTGGAGTACTTAAAAAAGCCGAGAGTGAATACAAAGGTCATAGATCTCTGTTGTCGAGGACCCGTAATCTACTTTCAACAATGCAGCGTCAAGATGTAATTGACAGGATAATCCTCATAGTTGGATTTTCTCTCTTTGTCTTTGCTGTTGTTTACGTTGTTTCAAAACGCATC
TRN  10010101100011001
NAM  O42852_SCHPO/122-213
ASQ  TSASQVTAAMRDIHAQMVQAVDMSAENAMELSSSTNLLETLQEKYFGVEDVLYTSKRIIKSLKLSDRSDYFLVVSGFGFFIFVVVYLLFKRI
DSQ  ACAAGCGCCAGTCAGGTCACGGCGGCTATGCGTGATATTCACGCACAAATGGTACAGGCAGTGGATATGAGTGCCGAAAATGCAATGGAGTTGTCTTCGAGTACCAACTTGTTAGAAACTCTACAAGAGAAATATTTTGGTGTAGAGGACGTTTTATATACAAGTAAACGGATAATCAAATCGCTCAAATTAAGTGATCGAAGTGATTACTTTTTAGTCGTCTCGGGATTTGGGTTCTTCATATTTGTGGTTGTCTATCTTCTCTTCAAGCGAATT
TRN  10010101110011010
NAM  SEC20_YEAST/204-295
ASQ  SKTKQLTNNLVRGNQILQSGILQSDLNLDELRAQTNSLTQIDDKYTQFETVFKKTADLVKVLENASHQEKRDVYLSLGFLLCCVSWVLWRRI
DSQ  AGCAAAACAAAACAACTGACGAATAACTTGGTGAGAGGAAATCAAATTTTGCAGTCCGGAATTTTACAAAGTGACCTGAATTTGGATGAATTGAGAGCCCAAACCAATTCCTTAACACAAATCGATGACAAGTACACTCAATTCGAAACCGTCTTCAAGAAAACTGCCGATTTGGTCAAAGTACTGGAAAATGCCTCCCATCAAGAGAAACGAGATGTCTATTTATCACTTGGGTTCCTCCTATGCTGCGTCTCGTGGGTTCTATGGCGTCGTATT
TRN  10010101100011000
NAM  Q9P887_CANAL/148-239
ASQ  SQNKQITKSLQASRQLLSAGILQSELNIDNIDQQTKDLYKLNEGFIQFNDLLNRSKKIVKFIEKQDKADRQRIYLSMGFFILCCSWVVYRRI
DSQ  AGCCAAAATAAACAAATAACAAAATCCTTGCAAGCATCGAGACAATTGTTATCAGCAGGTATATTGCAGAGTGAATTGAACATTGACAACATTGATCAGCAAACCAAGGATTTATACAAGTTAAATGAAGGATTTATCCAATTCAACGATTTGTTAAATAGATCTAAGAAAATTGTCAAGTTTATTGAAAAGCAAGATAAAGCTGACCGTCAACGTATATATTTGAGTATGGGGTTCTTCATACTTTGTTGTTCTTGGGTGGTTTATAGAAGAATT
TRN  10010101110011000
//