EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03899 - ATP_synt_I)
FAM  PF03899
PID  ATP_synt_I
DES  ATP synthase I chain
IPR  IPR005598
ANO  5
ALN  125
AID  0.417976
APH  ((Q9RFL9_ECO57/9-130:0.84161,(ATPZ_VIBAL/7-128:0.05702,ATPZ_VIBCH/7-128:0.22224):0.50001):0.73957,ATPZ_PSEPK/10-132:0.33619,Q9HT13_PSEAE/1-123:0.12182);
ATP  ((Q9RFL9_ECO57/9-130,(ATPZ_VIBAL/7-128,ATPZ_VIBCH/7-128)),ATPZ_PSEPK/10-132,Q9HT13_PSEAE/1-123);
ATL  2.81846
DNO  5
DLN  375
DID  0.496241
DPH  ((Q9RFL9_ECO57/9-130:0.55351,(ATPZ_VIBAL/7-128:0.13265,ATPZ_VIBCH/7-128:0.13627):0.37923):0.40757,ATPZ_PSEPK/10-132:0.23344,Q9HT13_PSEAE/1-123:0.21189);
DTP  ((Q9RFL9_ECO57/9-130,(ATPZ_VIBAL/7-128,ATPZ_VIBCH/7-128)),ATPZ_PSEPK/10-132,Q9HT13_PSEAE/1-123);
DTL  2.05456
RID  0.417976
RPH  ((Q9RFL9_ECO57/9-130:0.84161,(ATPZ_VIBAL/7-128:0.05702,ATPZ_VIBCH/7-128:0.22224):0.50001):0.73957,ATPZ_PSEPK/10-132:0.33619,Q9HT13_PSEAE/1-123:0.12182);
RTP  ((Q9RFL9_ECO57/9-130,(ATPZ_VIBAL/7-128,ATPZ_VIBCH/7-128)),ATPZ_PSEPK/10-132,Q9HT13_PSEAE/1-123);
RTL  2.81846
LNK  ATPZ_PSEPK/10-132:P25760:AE016794
LNK  ATPZ_VIBAL/7-128:P12983:X16050
LNK  ATPZ_VIBCH/7-128:Q9KNG8:AE004343
LNK  Q9HT13_PSEAE/1-123:Q9HT13:AE004967
LNK  Q9RFL9_ECO57/9-130:Q9RFL9:AE005174
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  ATPZ_VIBCH/7-128
ASQ  RQGRELAKRLLLIQFSAVMVAAAVFAVAVN-GDWGLSALVGGGIFVIANAVFAGCAFLFAG-ARALKMVAISFYTGEALKILITIVLFSVAYM-YMQLELVPLKLTYLLALGINICAPVLFINNK
DSQ  AGGCAAGGACGAGAGCTTGCAAAGCGATTGTTATTGATCCAGTTCAGTGCAGTTATGGTTGCGGCAGCTGTGTTTGCAGTGGCGGTAAAT---GGTGATTGGGGGCTTTCAGCCTTAGTCGGTGGTGGCATTTTTGTCATTGCTAACGCTGTTTTTGCGGGTTGTGCTTTCCTGTTTGCAGGG---GCGCGCGCGTTAAAAATGGTCGCCATCTCGTTTTATACGGGTGAAGCGCTGAAAATTCTCATCACTATCGTCCTGTTTTCCGTTGCCTACATG---TATATGCAGTTGGAACTTGTTCCACTGAAGCTAACCTATTTGCTGGCTCTAGGTATCAATATCTGTGCGCCAGTGCTATTCATTAACAACAAA
TRN  10010101100011000
NAM  ATPZ_VIBAL/7-128
ASQ  RPGRELARQLLMIQSGAVIFVAAGMAVAIN-PDWGFSALIGGGIFVVANAVFALCAFMFSG-ARAAKRIAASFYTGEVLKILITVALFYVAYM-YMQVELVPLKLTYLLVLGINICAPVLFINNK
DSQ  AGACCAGGACGAGAGCTCGCAAGGCAATTGTTAATGATCCAGTCTGGCGCGGTTATTTTTGTGGCAGCAGGAATGGCGGTAGCCATAAAT---CCTGACTGGGGATTTTCAGCGCTGATTGGCGGAGGCATTTTTGTTGTTGCCAATGCAGTATTCGCGCTGTGTGCTTTCATGTTTAGTGGG---GCTCGCGCTGCCAAGCGCATCGCGGCTTCCTTCTATACGGGTGAAGTACTGAAAATTCTCATCACGGTTGCACTGTTCTATGTTGCCTACATG---TATATGCAGGTGGAACTTGTTCCCCTCAAACTAACCTATTTGCTGGTACTAGGTATTAATATCTGTGCACCAGTGCTATTCATTAACAACAAA
TRN  10010101100011000
NAM  Q9HT13_PSEAE/1-123
ASQ  MPSRLPAFRLLLVQ-LVVVLVAAISLWISWGPVAGYSGLLGGMIAWLPNCYFAYKAFRFSG-ARAAREIVRSFYAGEAGKLILTAVLFALAFAGVKPLMAPALFGVYLLTLMVSWCAPLLMGKTF
DSQ  ATGCCAAGTCGCCTGCCGGCATTCAGATTGCTGCTCGTCCAA---CTGGTAGTAGTGCTTGTTGCTGCGATCTCCCTGTGGATTTCTTGGGGACCGGTAGCCGGATATTCCGGACTGCTGGGAGGGATGATCGCCTGGTTGCCGAATTGTTATTTCGCCTACAAGGCGTTCCGTTTCAGCGGA---GCGCGGGCTGCCCGGGAAATCGTTCGCTCTTTCTATGCGGGCGAAGCCGGGAAACTGATTCTGACGGCGGTGCTCTTCGCACTGGCGTTCGCAGGCGTGAAGCCACTGATGGCGCCGGCTCTGTTCGGTGTCTATCTGCTGACCCTGATGGTCAGCTGGTGCGCACCCCTGCTGATGGGAAAAACATTT
TRN  10010101100011011
NAM  ATPZ_PSEPK/10-132
ASQ  PFHRWAVFPVLLAQ-FVVLLLATLVLWQWKGSVSGYSGLCGGLIAWLPNVYFAWKAFRFSG-ARAAQAIVKSFYAGEAGKMILTAVLFALTFAGVKPLAPLAVFGVFVLTLLVSWFAPLLMNKRL
DSQ  CCTTTCCATCGCTGGGCGGTTTTTCCGGTACTGCTGGCTCAA---TTTGTCGTACTGCTGCTGGCAACCTTGGTGTTGTGGCAGTGGAAAGGGTCGGTCAGTGGATATTCAGGCCTTTGCGGAGGTTTGATTGCCTGGCTGCCCAATGTGTATTTCGCCTGGAAGGCTTTTCGCTTCAGCGGG---GCTCGGGCGGCACAAGCTATCGTCAAGTCGTTTTACGCTGGCGAGGCAGGCAAGATGATTTTGACGGCAGTGCTTTTTGCACTGACCTTTGCAGGAGTGAAGCCACTGGCGCCGCTAGCAGTATTCGGCGTCTTCGTGTTGACCCTTTTGGTCAGCTGGTTCGCGCCCCTGCTGATGAATAAAAGACTT
TRN  10010101100011001
NAM  Q9RFL9_ECO57/9-130
ASQ  LVSRNVARKLLLVQ--LLVVIASGLLFSLKDPFWGVSAISGGLAVFLPNVLFMIFAWRHQAHTPAKGRVAWTFAFGEAFKVLAMLVLLVVALA-VLKAVFLPLIVTWVLVLVVQILAPAVINNKG
DSQ  CTCGTGAGTCGAAACGTTGCTCGGAAGCTTCTGCTCGTTCAG------TTACTGGTGGTGATAGCAAGTGGATTGCTGTTCAGCCTCAAAGACCCCTTCTGGGGCGTCTCTGCAATAAGCGGGGGCCTGGCAGTCTTTCTGCCTAACGTTTTGTTTATGATATTTGCCTGGCGTCACCAGGCGCATACACCAGCGAAAGGCCGGGTGGCCTGGACATTCGCATTTGGTGAAGCTTTCAAAGTTCTGGCGATGTTGGTGTTACTGGTGGTGGCGTTGGCG---GTTTTAAAGGCGGTATTCTTGCCGCTGATCGTTACGTGGGTTTTGGTGCTGGTGGTTCAGATACTGGCACCGGCTGTAATTAACAACAAAGGG
TRN  10010101100011010
//