EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03678 - Adeno_hexon_C)
FAM  PF03678
PID  Adeno_hexon_C
DES  Hexon, adenovirus major coat protein, C-terminal domain
IPR  IPR000736
ANO  13
ALN  247
AID  0.602879
APH  ((((((((HEX_ADECC/588-815:0.11761,(HEX_ADE05/635-861:0.06403,HEX_ADE07/621-847:0.06290):0.11221):0.04080,O40957_ADEE2/586-813:0.19019):0.03325,HEX_ADEB3/598-821:0.32090):0.03315,HEX_ADEP3/621-849:0.12724):0.06028,HEX_ADEM1/592-819:0.27800):0.20032,((O71149_9ADEN/585-820:0.13826,Q83905_ADEO7/585-820:0.07045):0.12148,O11421_9ADEN/586-819:0.10720):0.25033):0.17290,Q9YUR1_9ADEN/588-815:0.24416):0.31407,HEX_ADEG1/606-852:0.10900,Q66853_ADEGX/600-846:0.11194);
ATP  ((((((((HEX_ADECC/588-815,(HEX_ADE05/635-861,HEX_ADE07/621-847)),O40957_ADEE2/586-813),HEX_ADEB3/598-821),HEX_ADEP3/621-849),HEX_ADEM1/592-819),((O71149_9ADEN/585-820,Q83905_ADEO7/585-820),O11421_9ADEN/586-819)),Q9YUR1_9ADEN/588-815),HEX_ADEG1/606-852,Q66853_ADEGX/600-846);
ATL  3.2835
DNO  13
DLN  741
DID  0.580837
DPH  ((Q83905_ADEO7/585-820:0.12847,O71149_9ADEN/585-820:0.14341):0.09264,((((((HEX_ADE07/621-847:0.14882,HEX_ADE05/635-861:0.10656):0.07695,((HEX_ADEP3/621-849:0.10622,(Q66853_ADEGX/600-846:0.14850,HEX_ADEG1/606-852:0.13897):0.33292):0.04009,HEX_ADEB3/598-821:0.30047):0.06341):0.05974,O40957_ADEE2/586-813:0.24670):0.09345,HEX_ADECC/588-815:0.15139):0.13302,HEX_ADEM1/592-819:0.22188):0.24069,Q9YUR1_9ADEN/588-815:0.30311):0.15238,O11421_9ADEN/586-819:0.20303);
DTP  ((Q83905_ADEO7/585-820,O71149_9ADEN/585-820),((((((HEX_ADE07/621-847,HEX_ADE05/635-861),((HEX_ADEP3/621-849,(Q66853_ADEGX/600-846,HEX_ADEG1/606-852)),HEX_ADEB3/598-821)),O40957_ADEE2/586-813),HEX_ADECC/588-815),HEX_ADEM1/592-819),Q9YUR1_9ADEN/588-815),O11421_9ADEN/586-819);
DTL  3.63282
RID  0.602879
RPH  ((((((((HEX_ADECC/588-815:0.11761,(HEX_ADE05/635-861:0.06403,HEX_ADE07/621-847:0.06290):0.11221):0.04080,O40957_ADEE2/586-813:0.19019):0.03325,HEX_ADEB3/598-821:0.32090):0.03315,HEX_ADEP3/621-849:0.12724):0.06028,HEX_ADEM1/592-819:0.27800):0.20032,((O71149_9ADEN/585-820:0.13826,Q83905_ADEO7/585-820:0.07045):0.12148,O11421_9ADEN/586-819:0.10720):0.25033):0.17290,Q9YUR1_9ADEN/588-815:0.24416):0.31407,HEX_ADEG1/606-852:0.10900,Q66853_ADEGX/600-846:0.11194);
RTP  ((((((((HEX_ADECC/588-815,(HEX_ADE05/635-861,HEX_ADE07/621-847)),O40957_ADEE2/586-813),HEX_ADEB3/598-821),HEX_ADEP3/621-849),HEX_ADEM1/592-819),((O71149_9ADEN/585-820,Q83905_ADEO7/585-820),O11421_9ADEN/586-819)),Q9YUR1_9ADEN/588-815),HEX_ADEG1/606-852,Q66853_ADEGX/600-846);
RTL  3.2835
LNK  HEX_ADE05/635-861:P04133:X02997
LNK  HEX_ADE07/621-847:P36851:X76551
LNK  HEX_ADEB3/598-821:P03278:K01264
LNK  HEX_ADECC/588-815:Q65955:U55001
LNK  HEX_ADEG1/606-852:P42671:U46933
LNK  HEX_ADEM1/592-819:P48308:M81889
LNK  HEX_ADEP3/621-849:Q9YTR8:AF083132
LNK  O11421_9ADEN/586-819:O11421:Y09598
LNK  O40957_ADEE2/586-813:O40957:L80007
LNK  O71149_9ADEN/585-820:O71149:AF036092
LNK  Q66853_ADEGX/600-846:Q66853:U26221
LNK  Q83905_ADEO7/585-820:Q83905:U40839
LNK  Q9YUR1_9ADEN/588-815:Q9YUR1:AF074946
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  O11421_9ADEN/586-819
ASQ  NATNDQNFSDYLGAVNNLYQIPANSTSVVVNVPDRSWGAFRGWSFTRIKARETPAIGATKDPNFTYSGSIPLLDGTFYLSHTFNRVSIQWDSSVPWPGNDRLLTPNWFEIKRNVNADPEGYTMSQSSITKDWFMVQMAANYNQAYQGYSLP---HTKFYDFLSNFEPMTRQIPDYS-KYFDLYTQYLQDPKKM-.-----PIWNNSGVQQMTNSPALLENTGHLYMANWPYPLIGTA--AVESQITE
DSQ  AACGCGACTAACGATCAGAATTTTTCTGATTATCTTGGCGCTGTTAATAATCTGTATCAGATTCCAGCCAACAGTACGAGCGTTGTGGTCAATGTCCCTGATAGATCTTGGGGAGCTTTTCGAGGTTGGTCGTTTACTAGAATTAAAGCTAGAGAGACGCCAGCAATTGGAGCCACAAAAGATCCGAATTTCACATATTCAGGATCAATTCCCCTGTTGGATGGCACATTTTACCTTTCTCATACTTTTAACAGGGTTTCTATTCAGTGGGATTCCAGTGTTCCCTGGCCTGGAAATGACAGATTGCTTACGCCAAATTGGTTTGAAATTAAACGCAATGTTAACGCTGATCCAGAAGGTTATACAATGTCACAAAGTTCTATCACCAAGGACTGGTTTATGGTGCAAATGGCAGCCAATTATAATCAAGCATATCAGGGCTATAGTTTGCCG---------CATACTAAATTCTACGATTTTCTCAGCAACTTTGAGCCGATGACGCGCCAAATTCCAGATTACTCA---AAGTATTTTGATTTGTACACCCAATACTTGCAGGATCCTAAAAAGATG---...---------------CCCATTTGGAATAACTCAGGGGTGCAGCAAATGACTAACTCTCCTGCTTTGCTGGAAAACACGGGTCACTTGTATATGGCTAACTGGCCATATCCTTTGATCGGTACGGCA------GCTGTAGAAAGTCAGATTACAGAG
TRN  10010101100011001
NAM  Q83905_ADEO7/585-820
ASQ  NATNDQNFADYLGAVTNLYQIPANTNTVVVNVPDRSWGAFRGWSFNRIKASETPMIGATKDPNFTYSGSIPLLDGTFYLTHTFQRVSIQWDSSVPWPGDDRLLIPNWFEIKRDPNMDAEGYTMSQSTITKDFYLVQMAANYNQAYQGYKLPV--HSKYYGFLENFQPMSRQVPIYGNGTYDLYTAYITNQRTM-.-----QIWNNSGLESKTSNPPMLSNTGHLYVANWPYPLIGPN--AIENQQTE
DSQ  AATGCTACTAATGATCAAAACTTTGCAGATTATTTGGGTGCGGTAACTAATCTTTATCAAATCCCAGCTAATACAAATACTGTAGTAGTGAACGTACCAGATAGATCTTGGGGTGCTTTCAGAGGATGGAGTTTCAATAGAATTAAAGCTTCAGAAACACCTATGATAGGAGCAACAAAAGATCCAAATTTTACTTATTCAGGATCTATACCGCTACTAGATGGTACTTTCTATTTAACACACACTTTTCAACGAGTTTCTATTCAGTGGGATTCTAGCGTTCCATGGCCAGGAGATGATAGGCTTTTGATTCCAAATTGGTTTGAAATTAAGAGAGATCCTAATATGGACGCAGAAGGTTATACTATGAGTCAAAGTACTATCACAAAAGATTTTTATTTGGTACAAATGGCTGCTAATTATAATCAAGCTTATCAAGGTTATAAATTGCCAGTA------CATTCTAAATATTATGGATTTTTAGAAAATTTTCAACCTATGAGTCGCCAAGTACCAATTTATGGTAATGGCACTTATGATTTATATACTGCTTATATTACAAACCAAAGAACCATG---...---------------CAAATTTGGAATAATAGTGGTTTAGAATCTAAAACTTCAAATCCTCCTATGTTATCCAACACTGGTCATCTTTATGTAGCTAACTGGCCATACCCTTTGATTGGACCAAAT------GCTATTGAAAACCAACAAACTGAA
TRN  10010101110011000
NAM  O71149_9ADEN/585-820
ASQ  NATNDQNFADYLGAVNNLYQIPPNTSTVVVNVPDRSWGAFRGWSFNRVKASETPMIGATKDPNFLYSGSIPYLDGTFYLTHTFQRVSIQWDSSVPWPGDDRLLIPNWFEIKRDYSIDAEATNMSQCNITKDWYMIQMAANYNQAYQGYKLPI--SHKYYGFLENFQPMSRQVPIYGGDLYDLYTEYIKNPNLM-.-----QIWNNCGLQQKTSGIPLLENSGHLYVANWPYPLIGKH--AIESQKLQ
DSQ  AATGCTACTAATGATCAAAATTTTGCAGACTATTTGGGAGCTGTTAACAATTTGTATCAGATTCCTCCCAATACTTCTACGGTTGTTGTTAATGTTCCGGATAGATCTTGGGGCGCTTTTAGAGGTTGGAGCTTTAACAGAGTTAAAGCATCGGAGACTCCCATGATAGGAGCTACAAAAGATCCCAACTTTTTATATTCTGGAAGCATTCCATATCTAGATGGCACGTTCTATTTAACACATACGTTTCAACGCGTTTCAATCCAGTGGGATTCTAGCGTGCCATGGCCCGGGGATGATAGGCTTCTTATACCAAATTGGTTTGAAATCAAGAGAGATTATTCAATTGATGCCGAAGCTACCAATATGAGTCAATGTAATATTACAAAAGACTGGTATATGATACAAATGGCTGCTAATTATAATCAAGCCTATCAAGGTTACAAACTTCCAATA------AGTCATAAATATTATGGTTTTCTTGAAAATTTTCAACCAATGAGTCGTCAAGTACCTATCTATGGAGGGGATTTATATGATTTATATACAGAATATATCAAAAATCCAAATTTGATG---...---------------CAAATTTGGAATAACTGTGGTTTGCAACAAAAAACTTCAGGTATTCCTTTACTAGAAAATTCTGGTCATTTGTATGTAGCTAACTGGCCTTATCCACTAATTGGAAAGCAT------GCTATTGAAAGTCAAAAACTGCAA
TRN  10010101100011000
NAM  HEX_ADEP3/621-849
ASQ  NDTNNQTFIDFLSSANMLYPIPANVTNLPISIPSRNWAAFRGWSFTRLKHNETPALGSPFDPYFTYSGSIPYLDGTFYLGHTFRRISIQFDSSVAWPGNDRLLTPNEFEVKR--TVDGEGYTVAQTNMTKDWFLVQMLAHYNIGYQGYHLPEGYRDRTYSFLRNFEPMCRQVPDYANHKDEYLEVPTTNQF---.--------NSSGFVSAA--FTAGMREGHPYPANWPYPLIGED--AVQTVTQR
DSQ  AACGACACCAACAACCAAACCTTTATTGACTTCCTCTCCTCCGCCAACATGCTCTACCCCATCCCGGCCAACGTCACCAACCTGCCCATCTCCATTCCCAGCCGCAACTGGGCCGCCTTCCGCGGCTGGAGCTTCACGCGGCTGAAGCACAACGAGACCCCCGCCCTGGGCTCGCCCTTCGACCCCTACTTTACCTACTCGGGCTCCATCCCCTACCTGGACGGGACCTTCTACCTGGGCCACACCTTCCGCCGCATCAGCATCCAGTTCGACTCCTCCGTGGCCTGGCCGGGCAATGACCGCCTGCTCACTCCCAACGAGTTCGAGGTCAAGCGC------ACCGTGGACGGGGAGGGCTACACGGTGGCCCAGACCAACATGACCAAAGACTGGTTCCTGGTGCAGATGCTCGCCCACTACAACATCGGCTACCAGGGATACCACCTGCCAGAGGGCTACCGCGACCGCACCTACTCCTTCCTGCGCAACTTTGAGCCCATGTGCCGCCAGGTGCCCGACTACGCCAACCACAAAGATGAGTACCTGGAGGTGCCCACCACCAACCAGTTC---------...------------------------AACAGCAGCGGCTTTGTATCCGCGGCC------TTCACCGCCGGCATGCGCGAGGGGCACCCATACCCCGCCAACTGGCCCTACCCGCTCATCGGCGAAGAC------GCCGTGCAGACCGTGACCCAGCGC
TRN  11011101101011011
NAM  HEX_ADECC/588-815
ASQ  NDVNDQSFADYLSAANMLYPIPANTTNLPISIPARNWAGFRGWSFTRIKQRETPALGSPYDPYFTYSGSIPYLDSTFYLSHTFRRVSIMFDSSVSWPGNDRLLTPNEFEIKR--YVDGEGYNVAQSNMTKDWFLVQMLAHYNIGYQGYHLPESYKDRMYSFLRNFEPMCRQLVDVTNY-ATYQSVTVGHQH---.--------NNSGYASPL--STFNPREGHPYPANWPYPLIGVN--AVPTVTQK
DSQ  AATGATGTAAATGACCAGTCCTTTGCAGACTACCTGTCTGCCGCCAACATGCTTTATCCGATCCCTGCCAACACTACAAACCTACCAATCTCCATTCCTGCCAGAAATTGGGCCGGATTCAGAGGGTGGAGCTTTACCAGAATTAAGCAGCGGGAAACTCCAGCCCTGGGCTCACCTTACGACCCCTACTTTACTTACTCGGGTAGCATTCCCTACCTGGATTCAACTTTCTATCTTAGCCACACCTTCAGAAGAGTCTCCATCATGTTTGACTCTTCTGTATCTTGGCCGGGCAATGACAGGCTCCTCACTCCAAATGAGTTTGAGATTAAAAGG------TATGTGGACGGTGAAGGCTACAACGTGGCCCAGTCCAACATGACAAAAGATTGGTTTCTGGTTCAAATGCTGGCTCATTACAACATTGGCTATCAAGGCTACCACTTGCCCGAGAGCTACAAAGACAGAATGTACTCATTCCTCAGAAATTTTGAGCCCATGTGCAGACAATTGGTAGATGTAACTAACTAT---GCTACCTACCAGTCAGTCACCGTAGGTCACCAGCAT---------...------------------------AACAATTCTGGATATGCTAGCCCCCTT------TCAACCTTTAACCCAAGGGAGGGTCACCCCTATCCGGCAAACTGGCCTTATCCCCTAATCGGGGTCAAT------GCTGTGCCTACTGTTACCCAAAAA
TRN  10010101100011001
NAM  HEX_ADE07/621-847
ASQ  NDTNDQSFNDYLSAANMLYPIPANATNIPISIPSRNWAAFRGWSFTRLKTKETPSLGSGFDPYFVYSGSIPYLDGTFYLNHTFKKVSIMFDSSVSWPGNDRLLSPNEFEIKR--TVDGEGYNVAQCNMTKDWFLVQMLANYNIGYQGFYIPEGYKDRMYSFFRNFQPMSRQVVDEVNYT-DYKAVTLPYQH---.--------NNSGFVGYL--AP-TMRQGEPYPANYPYPLIGTT--AVKSVTQK
DSQ  AACGATACCAATGATCAGTCATTCAACGACTACCTCTCTGCAGCTAACATGCTTTACCCCATCCCTGCCAATGCAACCAACATTCCAATTTCCATCCCATCTCGCAACTGGGCAGCCTTCAGGGGCTGGTCCTTCACTAGGCTCAAAACCAAGGAGACTCCATCTCTTGGATCAGGGTTCGATCCCTACTTCGTATATTCTGGATCTATTCCCTACCTGGATGGCACCTTTTACCTTAACCACACTTTCAAGAAGGTCTCCATCATGTTTGACTCCTCAGTCAGCTGGCCTGGCAATGACAGGCTGTTGAGCCCAAATGAGTTTGAAATCAAGCGC------ACTGTGGACGGGGAAGGGTACAATGTGGCCCAATGTAACATGACCAAAGACTGGTTCCTGGTTCAGATGCTTGCCAACTACAACATTGGCTACCAGGGCTTTTACATCCCTGAGGGATACAAGGATCGCATGTACTCCTTTTTCAGAAACTTCCAGCCTATGAGCAGGCAGGTGGTTGATGAGGTTAATTACACT---GACTACAAAGCCGTCACCTTACCATACCAACAC---------...------------------------AACAACTCTGGCTTTGTAGGGTATCTT------GCACCT---ACTATGAGACAAGGGGAACCTTACCCAGCCAATTATCCATACCCGCTCATCGGAACTACT------GCCGTTAAGAGTGTCACCCAGAAA
TRN  10010101100011000
NAM  HEX_ADE05/635-861
ASQ  NDTNDQSFNDYLSAANMLYPIPANATNVPISIPSRNWAAFRGWAFTRLKTKETPSLGSGYDPYYTYSGSIPYLDGTFYLNHTFKKVAITFDSSVSWPGNDRLLTPNEFEIKR--SVDGEGYNVAQCNMTKDWFLVQMLANYNIGYQGFYIPESYKDRMYSFFRNFQPMSRQVVDDTKYK-DYQQVGILHQH---.--------NNSGFVGYL--AP-TMREGQAYPANFPYPLIGKT--AVDSITQK
DSQ  AACGACACCAACGACCAGTCCTTTAACGACTATCTCTCCGCCGCCAACATGCTCTACCCTATACCCGCCAACGCTACCAACGTGCCCATATCCATCCCCTCCCGCAACTGGGCGGCTTTCCGCGGCTGGGCCTTCACGCGCCTTAAGACTAAGGAAACCCCATCACTGGGCTCGGGCTACGACCCTTATTACACCTACTCTGGCTCTATACCCTACCTAGATGGAACCTTTTACCTCAACCACACCTTTAAGAAGGTGGCCATTACCTTTGACTCTTCTGTCAGCTGGCCTGGCAATGACCGCCTGCTTACCCCCAACGAGTTTGAAATTAAGCGC------TCAGTTGACGGGGAGGGTTACAACGTTGCCCAGTGTAACATGACCAAAGACTGGTTCCTGGTACAAATGCTAGCTAACTACAACATTGGCTACCAGGGCTTCTATATCCCAGAGAGCTACAAGGACCGCATGTACTCCTTCTTTAGAAACTTCCAGCCCATGAGCCGTCAGGTGGTGGATGATACTAAATACAAG---GACTACCAACAGGTGGGCATCCTACACCAACAC---------...------------------------AACAACTCTGGATTTGTTGGCTACCTT------GCCCCC---ACCATGCGCGAAGGACAGGCCTACCCTGCTAACTTCCCCTATCCGCTTATAGGCAAGACC------GCAGTTGACAGCATTACCCAGAAA
TRN  10010101100011001
NAM  O40957_ADEE2/586-813
ASQ  NDTNDQSFIDYLSAANMLYTIPAGATQVPISIPSRNWAAFRGWSFTRIKAKETPALGSPFEPYFNYSGTIPYLDGTFYLSHTFRRVSVQFDSSALGPETTVFFTPNEFEIKR--LIDGEGYNVSQSNMTKDWFLVQMLAHYNIGYQGYHLPESYKDRWYGPLRNFQPLCRQVPDPLRFT-DYKAVSVLNQH---.--------NNSGFTGYN--SAGLMREGQPYPANWPYPLIGKN--AVASVTER
DSQ  AACGATACCAACGATCAGTCTTTCATAGATTACTTATCGGCGGCTAACATGCTTTACACCATCCCCGCCGGGGCCACCCAAGTTCCCATATCGATCCCATCAAGAAACTGGGCCGCTTTCCGCGGGTGGAGTTTCACCCGGATCAAGGCCAAAGAAACCCCAGCGCTAGGTTCGCCCTTCGAACCCTACTTCAACTATAGTGGAACCATTCCCTATCTCGACGGAACCTTCTATCTCAGTCACACCTTTAGGAGGGTTTCCGTTCAGTTTGACTCCTCCGCACTTGGCCCGGAAACGACCGTCTTCTTCACTCCTAATGAGTTTGAGATCAAACGC------CTTATCGATGGAGAAGGCTATAACGTGTCGCAGAGCAACATGACTAAAGACTGGTTTTTGGTTCAGATGTTGGCCCACTACAACATCGGGTATCAAGGTTATCACCTACCGGAATCTTACAAAGATAGGTGGTATGGTCCTCTACGAAACTTTCAACCGCTCTGTCGTCAGGTGCCTGACCCTCTTCGTTTCACC---GACTACAAAGCCGTCTCTGTCTTGAATCAACAC---------...------------------------AATAACTCTGGTTTTACGGGCTACAAC------AGCGCTGGACTCATGCGCGAGGGACAACCTTATCCCGCTAACTGGCCTTATCCCCTGATTGGCAAAAAC------GCCGTCGCGAGCGTCACAGAACGC
TRN  10010101100011000
NAM  HEX_ADEM1/592-819
ASQ  NETNDQTFLDYLSSATMMFPIPAGQTQVPVSIPARNWAAFRGWSFTRIKQQETPNIGSPYDPYFKYSGSIPFLDATFYLTHTFQRVSIMFDSSVSWPGNDRLLTPNEFEIKR--HIDAEGLCVGQSNMTKDWFLVQMLSNYNIGYQGFYLPENNKDRTYSFVRNFEPLARQVVDDAAAA-NYRDVPLSKRF---.--------NNSGWRSAG--PPIFAREGAPYPANWPYPLCGEA--AWAAKTQR
DSQ  AATGAAACAAATGACCAGACTTTTTTGGACTACCTGAGCAGCGCAACGATGATGTTTCCCATTCCTGCAGGTCAAACCCAAGTGCCAGTATCAATTCCAGCCAGAAACTGGGCAGCCTTTAGGGGTTGGAGCTTTACTCGTATTAAACAACAAGAAACGCCCAACATAGGCTCACCGTATGACCCGTACTTTAAGTACAGCGGAAGCATACCTTTCTTGGATGCTACTTTTTACCTAACACACACCTTTCAGCGAGTTTCAATTATGTTTGACTCTTCAGTAAGTTGGCCAGGAAACGACCGACTTCTAACTCCAAACGAGTTTGAAATAAAACGT------CACATTGACGCTGAAGGACTATGTGTGGGTCAAAGTAACATGACTAAGGACTGGTTTTTGGTGCAAATGCTGTCCAACTACAACATCGGATATCAGGGCTTTTATTTACCAGAAAACAACAAAGACAGAACATACTCTTTTGTTCGAAACTTTGAACCCCTGGCCCGGCAAGTGGTGGATGATGCTGCTGCGGCT---AACTATCGAGACGTTCCTCTTTCCAAAAGATTT---------...------------------------AACAATTCGGGTTGGAGAAGCGCCGGT------CCTCCAATATTTGCTCGAGAGGGGGCGCCTTATCCTGCTAACTGGCCCTATCCACTGTGTGGAGAGGCG------GCATGGGCTGCAAAAACCCAAAGA
TRN  10010101100011000
NAM  HEX_ADEB3/598-821
ASQ  NDTNDQSFNDYLSAANMLYPIPPNATQLP--IPSRNWAAFRGWSLTRLKQRETPALGSPFDPYFTYSGTIPYLDGTFYLSHTFRKVAIQFDSSVTWPGNDRLLTPNEFEIKI--SVDGEGYNVAQSNMTKDWFLVQMLANYNIGYQGYHLPPDYKDRTFSFLHNFIPMCRQVPNPATE--GYFGLGIVNHR---.--------TTPAYWFR---FCRAPREGHPYPQLALPPHWDPR--HALRDPER
DSQ  AACGACACTAATGACCAGTCTTTTAATGACTATCTCTCGGCGGCTAACATGTTGTATCCCATTCCGCCCAATGCCACCCAACTGCCC------ATCCCCTCACGCAACTGGGCAGCGTTCCGTGGCTGGAGTCTCACCCGGCTAAAACAGAGGGAGACACCGGCGCTGGGGTCCCCGTTCGATCCCTATTTCACCTATTCGGGCACCATCCCGTACCTGGACGGCACTTTTTACCTCAGCCACACCTTTCGCAAGGTGGCCATCCAGTTTGACTCTTCTGTGACCTGGCCCGGCAATGACAGGCTTTTAACCCCTAACGAGTTCGAAATAAAAATA------AGTGTGGACGGTGAAGGCTACAACGTGGCTCAGAGCAATATGACTAAGGACTGGTTCCTGGTGCAGATGCTAGCGAATTACAACATAGGCTACCAGGGATATCACCTGCCCCCGGACTACAAGGACAGGACATTTTCCTTCCTGCATAACTTCATACCCATGTGCCGACAGGTTCCCAACCCAGCAACCGAG------GGCTACTTTGGACTAGGCATAGTGAACCATAGA---------...------------------------ACAACTCCGGCTTATTGGTTTCGA---------TTCTGCCGCGCTCCGCGCGAGGGCCACCCCTACCCCCAACTGGCCTTACCCCCTCATTGGGACCCACGC------CATGCCCTCCGTGACCCAGAGAGA
TRN  10010101100011000
NAM  Q66853_ADEGX/600-846
ASQ  NATNDQTFVDYLGAKNALYSVPAGSTALTINIPARTWEGMRGWSFTRIKAAETPQLGAQYDVNFKYSGSMRYSDGGFYLSHTFRNMSILFDTSINWPGNDRLLTPNMFEIKRSVALDTEGFTMSQCDITKDWYLIQMATNYNFVYNGYRFWPDRQYFQYDFLRNFDPMTRQGPNFALPGLFDLVSYTPTTDNSGeQPSQEAVRNNSGFIAPRSWPVWSAHQGESWPANWPYPLCGQQAIQPGQVLSY
DSQ  AACGCCACCAACGATCAGACCTTCGTGGACTACCTGGGAGCCAAAAACGCTCTATACTCGGTGCCCGCGGGTTCCACCGCCCTCACCATCAACATTCCCGCTCGCACCTGGGAGGGGATGCGCGGGTGGTCCTTCACTCGCATCAAGGCGGCCGAGACGCCTCAGCTGGGCGCCCAGTACGACGTCAACTTCAAGTACTCGGGCAGCATGCGCTACTCAGACGGAGGCTTCTACCTCTCGCACACCTTCCGTAACATGAGCATCCTCTTCGACACGTCCATCAACTGGCCGGGCAACGACCGGTTGCTCACGCCTAACATGTTCGAGATCAAGCGCTCGGTGGCGCTCGACACCGAGGGCTTCACCATGAGCCAGTGCGACATCACCAAGGACTGGTACCTGATCCAGATGGCCACCAACTACAACTTCGTCTATAACGGCTATCGGTTCTGGCCCGACCGTCAGTACTTCCAGTACGACTTCCTGCGAAATTTCGACCCCATGACGCGCCAGGGACCCAACTTCGCATTGCCAGGCCTCTTCGATCTCGTGTCTTACACCCCTACCACGGACAACAGCGGAgagCAGCCTAGTCAGGAAGCCGTGCGCAACAACTCTGGCTTTATCGCCCCCCGCTCCTGGCCCGTCTGGAGCGCTCACCAGGGCGAGAGCTGGCCCGCCAACTGGCCGTACCCGCTCTGCGGTCAGCAGGCCATCCAACCCGGACAGGTCCTCAGCTAC
TRN  11011101101011001
NAM  HEX_ADEG1/606-852
ASQ  NATNDQTFADYLGAKNALYNVPAGSTLLTINIPARTWEGMRGWSFTRLKASETPQLGAQYDVGFKYSGSIPYSDGTFYLSHTFRSMSVLFDTSINWPGNDRLLTPNLFEIKRPVATDSEGFTMSQCDMTKDWFLVQMATNYNYVYNGYRFWPDRHYFHYDFLRNFDPMSRQGPNFLDTTLYDLVSSTPVVNDTGsQPSQDNVRNNSGFIAPRSWPVWTAQQGEAWPANWPYPLIGNDAISSNQTVNY
DSQ  AACGCTACCAACGACCAGACCTTCGCGGACTACTTGGGCGCCAAGAACGCTCTCTACAACGTTCCGGCCGGCTCCACGCTGCTGACCATCAATATTCCCGCCAGAACATGGGAGGGTATGCGGGGCTGGTCTTTTACCCGCCTCAAGGCCTCGGAGACGCCCCAGCTGGGCGCTCAGTACGACGTCGGTTTCAAGTATTCAGGCTCCATTCCCTATTCGGATGGCACCTTTTACCTGTCCCACACGTTCCGCAGTATGAGCGTGTTGTTTGATACCTCTATCAACTGGCCTGGCAACGACCGTCTGCTCACACCTAACCTGTTCGAGATCAAGAGGCCAGTGGCCACCGACAGCGAAGGCTTCACTATGTCGCAGTGCGACATGACCAAGGACTGGTTCCTCGTGCAGATGGCCACCAACTACAACTACGTGTACAACGGTTATAGGTTCTGGCCTGACAGACACTACTTCCACTATGACTTCCTACGCAACTTCGACCCCATGTCGCGTCAGGGCCCCAACTTCCTGGACACCACGCTGTACGACCTGGTGTCCAGCACTCCCGTTGTTAACGACACCGGCtcaCAGCCGTCTCAGGACAACGTGCGTAACAACTCCGGCTTTATCGCCCCTCGCAGCTGGCCCGTATGGACCGCACAGCAGGGCGAAGCCTGGCCCGCTAACTGGCCGTACCCGCTGATCGGGAACGACGCCATCAGTTCCAACCAAACCGTCAACTAC
TRN  10010101100011001
NAM  Q9YUR1_9ADEN/588-815
ASQ  NDQNDQTFMDYMGAKNNLYLVPANQTNVQIEIPSRAWTAFRGWSFNRIKTAETPAVWSTYDLNFKYSGSIPYLDGTFYLSHTFNSMSILFDSAITWPGNDRMLVPNFFEIKR--EIDTEGYTTSQSNMTKDWYLIQMSANYNQGYHGYSFPADKVYRQYDFMSNFDSMSVQVPRSGLAFLFN---------EN-.---YNLIVNNSGFLPSRTAPIAGVNEGHPYPANWPAPLIGN---SPDSVVTV
DSQ  AACGATCAAAATGATCAAACTTTTATGGATTATATGGGTGCAAAGAATAATTTGTATTTAGTTCCTGCTAATCAAACTAATGTTCAGATTGAAATACCTTCTAGAGCTTGGACAGCATTTAGAGGCTGGAGTTTTAACCGAATTAAAACTGCTGAGACACCAGCTGTGTGGTCTACTTATGATCTTAATTTTAAATATTCTGGCTCAATACCTTATCTAGATGGTACATTTTATCTTTCTCACACTTTTAACTCTATGTCTATTTTGTTTGATTCAGCAATAACATGGCCAGGTAATGATAGAATGTTAGTTCCGAATTTTTTTGAAATAAAAAGA------GAGATAGATACGGAGGGATACACTACTAGTCAGTCTAATATGACTAAAGATTGGTATTTGATTCAAATGTCTGCAAATTATAACCAGGGGTATCACGGTTATAGTTTTCCAGCAGATAAAGTATACAGACAGTATGATTTTATGTCAAATTTTGATTCTATGTCTGTTCAAGTACCCCGGTCAGGTCTGGCATTTTTGTTTAAT---------------------------GAAAAT---...---------TATAACTTGATAGTAAATAATTCAGGATTTTTGCCCAGTAGGACGGCTCCAATTGCTGGAGTTAATGAAGGCCATCCTTATCCAGCAAACTGGCCAGCGCCATTAATAGGTAAT---------AGTCCTGATAGTGTTGTTACAGTT
TRN  10010101100011000
//