EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03609 - EII-Sor)
FAM  PF03609
PID  EII-Sor
DES  PTS system sorbose-specific iic component
IPR  IPR004700
ANO  17
ALN  244
AID  0.392884
APH  ((((((((((Q9S4L4_STRSL/4-242:0.13132,Q99YE5_STRPY/4-242:0.12950):0.03699,Q97SP3_STRPN/1-239:0.11685):0.07725,Q9CEX7_LACLA/3-242:0.35541):0.10194,Q97TN1_CLOAB/3-240:0.24622):0.25199,((Q48521_LACCU/1-235:0.08220,PTFC_BACSU/1-235:0.09952):0.23615,((PTRC_KLEPN/3-238:0.15042,Q9RGG3_LACCA/3-238:0.21428):0.16380,(Q9CMJ1_PASMU/3-238:0.19785,PTNC_ECOLI/3-238:0.09583):0.08977):0.07572):0.17199):0.49791,Q97N93_STRPN/1-235:0.76690):0.15592,Q99ZV2_STRPY/1-230:1.02288):0.17225,Q97SK8_STRPN/3-238:0.93786):0.27563,Q9KIP7_ECOLI/4-239:0.82330):0.38281,Q9KIQ3_ECOLI/3-237:0.21689,P96163_VIBFU/3-237:0.08930);
ATP  ((((((((((Q9S4L4_STRSL/4-242,Q99YE5_STRPY/4-242),Q97SP3_STRPN/1-239),Q9CEX7_LACLA/3-242),Q97TN1_CLOAB/3-240),((Q48521_LACCU/1-235,PTFC_BACSU/1-235),((PTRC_KLEPN/3-238,Q9RGG3_LACCA/3-238),(Q9CMJ1_PASMU/3-238,PTNC_ECOLI/3-238)))),Q97N93_STRPN/1-235),Q99ZV2_STRPY/1-230),Q97SK8_STRPN/3-238),Q9KIP7_ECOLI/4-239),Q9KIQ3_ECOLI/3-237,P96163_VIBFU/3-237);
ATL  8.36668
DNO  17
DLN  732
DID  0.495965
DPH  ((((((((Q9CMJ1_PASMU/3-238:0.24912,(PTNC_ECOLI/3-238:0.16648,(PTRC_KLEPN/3-238:0.22528,Q9RGG3_LACCA/3-238:0.27331):0.14949):0.05725):0.08087,(Q48521_LACCU/1-235:0.19961,PTFC_BACSU/1-235:0.17249):0.15979):0.10292,(Q97TN1_CLOAB/3-240:0.26357,((Q97SP3_STRPN/1-239:0.15145,(Q9S4L4_STRSL/4-242:0.12376,Q99YE5_STRPY/4-242:0.16078):0.04490):0.04926,Q9CEX7_LACLA/3-242:0.25108):0.14351):0.12394):0.24748,Q97N93_STRPN/1-235:0.47530):0.11481,Q97SK8_STRPN/3-238:0.54455):0.04952,Q99ZV2_STRPY/1-230:0.54070):0.16764,Q9KIP7_ECOLI/4-239:0.50983):0.25233,Q9KIQ3_ECOLI/3-237:0.19030,P96163_VIBFU/3-237:0.21602);
DTP  ((((((((Q9CMJ1_PASMU/3-238,(PTNC_ECOLI/3-238,(PTRC_KLEPN/3-238,Q9RGG3_LACCA/3-238))),(Q48521_LACCU/1-235,PTFC_BACSU/1-235)),(Q97TN1_CLOAB/3-240,((Q97SP3_STRPN/1-239,(Q9S4L4_STRSL/4-242,Q99YE5_STRPY/4-242)),Q9CEX7_LACLA/3-242))),Q97N93_STRPN/1-235),Q97SK8_STRPN/3-238),Q99ZV2_STRPY/1-230),Q9KIP7_ECOLI/4-239),Q9KIQ3_ECOLI/3-237,P96163_VIBFU/3-237);
DTL  6.4626
RID  0.392884
RPH  ((((((((((Q9S4L4_STRSL/4-242:0.13132,Q99YE5_STRPY/4-242:0.12950):0.03699,Q97SP3_STRPN/1-239:0.11685):0.07725,Q9CEX7_LACLA/3-242:0.35541):0.10194,Q97TN1_CLOAB/3-240:0.24622):0.25199,((Q48521_LACCU/1-235:0.08220,PTFC_BACSU/1-235:0.09952):0.23615,((PTRC_KLEPN/3-238:0.15042,Q9RGG3_LACCA/3-238:0.21428):0.16380,(Q9CMJ1_PASMU/3-238:0.19785,PTNC_ECOLI/3-238:0.09583):0.08977):0.07572):0.17199):0.49791,Q97N93_STRPN/1-235:0.76690):0.15592,Q99ZV2_STRPY/1-230:1.02288):0.17225,Q97SK8_STRPN/3-238:0.93786):0.27563,Q9KIP7_ECOLI/4-239:0.82330):0.38281,Q9KIQ3_ECOLI/3-237:0.21689,P96163_VIBFU/3-237:0.08930);
RTP  ((((((((((Q9S4L4_STRSL/4-242,Q99YE5_STRPY/4-242),Q97SP3_STRPN/1-239),Q9CEX7_LACLA/3-242),Q97TN1_CLOAB/3-240),((Q48521_LACCU/1-235,PTFC_BACSU/1-235),((PTRC_KLEPN/3-238,Q9RGG3_LACCA/3-238),(Q9CMJ1_PASMU/3-238,PTNC_ECOLI/3-238)))),Q97N93_STRPN/1-235),Q99ZV2_STRPY/1-230),Q97SK8_STRPN/3-238),Q9KIP7_ECOLI/4-239),Q9KIQ3_ECOLI/3-237,P96163_VIBFU/3-237);
RTL  8.36668
LNK  P96163_VIBFU/3-237:P96163:U65015
LNK  PTFC_BACSU/1-235:P26381:X56098
LNK  PTNC_ECOLI/3-238:P08187:J02699
LNK  PTRC_KLEPN/3-238:P37082:X66059
LNK  Q48521_LACCU/1-235:Q48521:U28163
LNK  Q97N93_STRPN/1-235:Q97N93:AE007504
LNK  Q97SK8_STRPN/3-238:Q97SK8:AE007344
LNK  Q97SP3_STRPN/1-239:Q97SP3:AE007341
LNK  Q97TN1_CLOAB/3-240:Q97TN1:AE001438
LNK  Q99YE5_STRPY/4-242:Q99YE5:AE006602
LNK  Q99ZV2_STRPY/1-230:Q99ZV2:AE006550
LNK  Q9CEX7_LACLA/3-242:Q9CEX7:AE006401
LNK  Q9CMJ1_PASMU/3-238:Q9CMJ1:AE006122
LNK  Q9KIP7_ECOLI/4-239:Q9KIP7:AF228498
LNK  Q9KIQ3_ECOLI/3-237:Q9KIQ3:AF228498
LNK  Q9RGG3_LACCA/3-238:Q9RGG3:AF129168
LNK  Q9S4L4_STRSL/4-242:Q9S4L4:AF130465
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.........xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  PTNC_ECOLI/3-238
ASQ  ITTLQIVLVFIVACIAGMGSILDEFQFHRPLIACTLVGIVLGDMKTGIIIGGTLEMIALGWMN.IGAAVAPDAALASIISTILVIAGHQS...--IGAGIALAIPLAAAGQVLTIIVRTITV.AFQHAADKAADNGNLTAISWIHVSSLFLQAMRVAIPAVIVALSVGTSEVQNMLNAIPEVVTNGLNIAGGMIVVVGYAMVINMMRAGYLMPFFYLGFVTAAFTNFN.LVALGVIGTVMAVLY
DSQ  ATTACCACTCTTCAAATTGTGCTGGTATTTATCGTAGCCTGTATCGCAGGTATGGGATCAATCCTCGATGAATTTCAGTTTCACCGTCCGCTAATCGCGTGTACCCTGGTGGGTATCGTTCTTGGGGATATGAAAACCGGTATTATTATCGGTGGTACGCTGGAAATGATCGCGCTGGGCTGGATGAAC...ATCGGTGCTGCAGTTGCGCCTGACGCCGCTCTGGCTTCTATCATTTCTACCATTCTGGTTATCGCAGGTCATCAGAGC.........------ATTGGTGCAGGTATCGCACTGGCAATCCCTCTGGCCGCTGCGGGCCAGGTACTGACCATCATCGTTCGTACTATTACCGTT...GCTTTCCAGCACGCTGCGGATAAGGCTGCTGATAACGGCAACCTGACAGCGATTTCCTGGATCCACGTTTCTTCTCTGTTCCTGCAAGCAATGCGTGTGGCTATTCCGGCCGTCATCGTTGCGCTGTCTGTTGGTACCAGCGAAGTACAGAACATGCTGAATGCGATTCCGGAAGTGGTGACCAATGGTCTGAATATCGCCGGTGGCATGATCGTGGTGGTTGGTTATGCGATGGTTATCAACATGATGCGTGCTGGCTACCTGATGCCGTTCTTCTACCTCGGCTTCGTAACCGCAGCATTCACCAACTTTAAC...CTGGTTGCTCTGGGTGTGATTGGTACTGTTATGGCAGTGCTCTAC
TRN  11011101101011001
NAM  Q9CMJ1_PASMU/3-238
ASQ  ISTLQIVLVFLVACVSGMGSILDEWQTHRPLIACTLIGLVLGDIKTGIIVGGTLELLALGWMN.IGAALAPDAALASVVSTILVIVGGQD...--ISTGIAIAIPLAAAGQVLTYVVRAITV.GFQHAADNVVESGDLNKLDWIHRSALLLQAMRIAIPALIVAMTAGTDTVQTMLSAIPDVVTTGLKIAGGFIAVVGYAMVINMMRAGHLMPFFYAGFVIAAFTEFN.LVALGVLGAIMAVLY
DSQ  ATTTCAACTTTACAAATTGTACTTGTCTTTCTCGTTGCTTGTGTATCAGGAATGGGATCGATTTTGGATGAATGGCAAACACACCGTCCGTTGATTGCTTGTACGTTAATTGGTCTTGTCTTAGGTGACATTAAGACGGGTATCATTGTTGGTGGTACGCTTGAATTGTTAGCCTTAGGCTGGATGAAT...ATCGGAGCAGCATTAGCGCCAGATGCGGCGTTGGCTTCTGTTGTATCGACTATTCTGGTTATTGTCGGTGGTCAAGAT.........------ATTTCAACTGGTATTGCGATTGCGATTCCATTGGCGGCAGCCGGTCAAGTCTTAACTTATGTTGTCCGTGCGATTACGGTT...GGTTTCCAACATGCCGCGGATAATGTTGTTGAGAGCGGTGATCTGAATAAATTAGATTGGATTCACCGTTCCGCTTTGTTATTACAAGCTATGCGTATTGCAATCCCTGCATTAATTGTTGCCATGACGGCGGGAACAGATACGGTTCAAACTATGTTAAGTGCGATTCCTGATGTGGTGACGACCGGGCTTAAAATAGCGGGTGGATTCATTGCTGTCGTGGGTTACGCAATGGTGATCAATATGATGCGTGCAGGGCATTTAATGCCATTCTTCTATGCAGGTTTTGTGATTGCTGCCTTTACGGAATTTAAC...TTAGTGGCATTAGGGGTATTAGGCGCGATCATGGCGGTGCTTTAT
TRN  10010101100011000
NAM  Q9RGG3_LACCA/3-238
ASQ  ISTIQIILIFIWSSVVGMGSVLDEFQTHRPLIACSIMGLILGDPKTGIILGGTLELIALGWMN.IGAAQSPDSALASTISTILVIVGNQD...--IQKGIAIALPVAAAGQVLTVLARTVTV.AFQHAADREAEKANFTAIIWLHFTALIVQALRVSIPTTIVAVFVSPEEIKSMLDALPEVITGGLAVAGGFIVVVGYAMILNMMSVKYLMPFFYQGFVLGGYLKLS.LLAWGAVGLIFAIVY
DSQ  ATTTCTACCATTCAAATTATTCTTATCTTCATCTGGTCCTCCGTAGTCGGTATGGGGAGCGTTCTGGATGAATTTCAGACACATCGACCTTTGATTGCGTGTTCAATTATGGGCCTGATCTTAGGAGATCCAAAGACCGGGATCATTTTAGGCGGCACTCTGGAACTTATTGCCCTTGGCTGGATGAAT...ATCGGGGCTGCACAGTCTCCAGATTCAGCTTTGGCAAGTACCATTTCAACAATCTTAGTTATTGTGGGTAATCAGGAT.........------ATTCAAAAGGGGATCGCGATTGCTTTGCCTGTAGCGGCTGCAGGTCAGGTTCTCACTGTTCTGGCACGGACTGTTACGGTG...GCATTTCAACATGCTGCTGACCGTGAGGCGGAAAAAGCGAACTTTACTGCCATCATATGGTTACACTTTACAGCCTTAATTGTACAAGCGCTCCGGGTCTCAATTCCGACCACGATTGTTGCGGTTTTCGTAAGTCCAGAAGAGATTAAGAGCATGTTAGATGCATTGCCAGAGGTAATTACTGGAGGACTAGCAGTAGCTGGAGGATTCATTGTGGTTGTTGGGTACGCAATGATTCTTAATATGATGAGTGTTAAGTACTTAATGCCATTCTTCTATCAAGGCTTTGTTCTCGGCGGTTATTTGAAACTAAGT...TTGCTAGCTTGGGGCGCTGTTGGACTGATCTTTGCGATTGTCTAC
TRN  10010101100011000
NAM  PTRC_KLEPN/3-238
ASQ  ISTLQIIAIFIFSCIAGMGSVLDEFQTHRPLIACTVIGLILGDLKTGVMLGGTLELIALGWMN.VGAAQSPDSALASIISAILVIVGHQS...--IAIGIAIALPVAAAGQVLTVFARTITV.VFQHAADKAAEEARFRTIDLLHVSALGVQGLRVAIPALVVSLFVSADMVSSMLSAIPEFVTRGLQIAGGFIVVVGYAMVLRMMGVKYLMPFFFLGFLAGGYLDFS.LLAFGGVGVIIALIY
DSQ  ATTAGTACCCTACAGATAATAGCCATATTTATTTTTTCCTGTATTGCCGGAATGGGCAGCGTGCTGGATGAATTTCAGACCCATCGGCCCCTTATCGCCTGTACCGTGATTGGCCTCATCCTGGGCGATTTAAAAACCGGGGTTATGCTCGGCGGTACGCTGGAGCTGATCGCCCTCGGCTGGATGAAC...GTGGGGGCAGCGCAGTCGCCAGATTCGGCGCTGGCCAGCATTATCTCCGCCATTCTGGTGATTGTGGGCCACCAGAGC.........------ATTGCCATTGGTATCGCCATTGCTCTGCCGGTGGCCGCCGCCGGGCAGGTGCTGACCGTTTTCGCCCGTACCATTACCGTG...GTGTTCCAGCACGCCGCGGACAAAGCGGCCGAGGAGGCGCGCTTTCGCACCATCGACCTGCTGCATGTCTCCGCGCTGGGGGTGCAGGGCCTGCGCGTGGCAATCCCGGCGCTGGTGGTCTCGCTGTTCGTTAGCGCGGATATGGTCAGCAGTATGCTCAGCGCGATCCCGGAATTCGTCACCCGCGGCCTGCAGATTGCCGGTGGTTTCATTGTCGTCGTGGGCTACGCGATGGTGCTGCGAATGATGGGCGTGAAATACCTGATGCCCTTCTTTTTCCTCGGTTTTCTCGCCGGGGGTTATCTCGACTTCAGC...CTGCTGGCCTTCGGCGGCGTGGGCGTCATCATCGCGCTGATCTAC
TRN  10010101100011010
NAM  PTFC_BACSU/1-235
ASQ  MSSLQIILLLIIAAITGIASVLDEGQTHRPLVACTLVGLVLGDLKTGIILGGTLELMALGWMN.VGLAMAPDTAIASVISTILVITADQG...--IGEGIAVAVALAAAGQALTIFVRTITV.FFIHRADQYAKAGNIKGIEIMHITAMVFQALRVMIPTLIVALIS-VSAVQAFLGNIPDVITKGLQIGGGIIVVVGYAMVINMMNIPYLKPFFYIGFLLAAFTDFN.LVGFGALGLCLALLY
DSQ  ATGTCTTCATTACAAATTATTTTGTTGTTAATCATTGCAGCAATCACCGGAATCGCAAGTGTATTGGATGAAGGGCAGACACACCGGCCGCTAGTGGCCTGTACGTTGGTTGGCTTGGTGCTCGGGGACTTAAAAACGGGAATTATTCTTGGAGGCACACTGGAGCTGATGGCGCTCGGCTGGATGAAC...GTCGGGCTTGCCATGGCACCTGATACAGCGATCGCCTCTGTCATCTCAACCATTTTAGTTATTACCGCTGATCAAGGA.........------ATTGGCGAAGGGATTGCTGTCGCTGTTGCTTTAGCAGCTGCGGGTCAGGCGCTGACGATTTTTGTTCGGACGATCACTGTC...TTTTTCATCCACCGCGCTGATCAATATGCAAAAGCGGGAAATATAAAAGGAATTGAAATTATGCATATTACCGCGATGGTGTTTCAAGCTTTGCGCGTCATGATTCCTACATTGATTGTTGCTTTAATTAGT---GTCAGCGCTGTTCAGGCGTTCCTGGGAAATATTCCTGATGTCATTACAAAAGGACTGCAAATAGGCGGAGGCATTATTGTGGTTGTCGGGTATGCCATGGTGATCAATATGATGAATATTCCTTATTTAAAGCCATTTTTCTATATTGGTTTCTTATTAGCGGCGTTTACCGATTTTAAC...TTAGTGGGATTTGGAGCCCTTGGTCTCTGTCTGGCGCTTTTATAC
TRN  10010101100011000
NAM  Q48521_LACCU/1-235
ASQ  MSAIQIILLMVVAAITGIGSVLDEAQTHRPLVACTLVGLILGDLQTGIILGGTLEMMALGWMN.VGLAMAPDTAIASVISTILVITAHQG...--LGEGIAIAVPLAAAGQALTIFVRTITV.FFVHKADDYAKNGNFKGIERMHILALVFQALRVMIPTLIICLIS-ASAVSHFLNGIPEVITGGLQIGGGIIVVVGYAMVINMMDVPYLKPFFYMGFLFAAFTNFN.LVGFGGLGLCLALLF
DSQ  ATGAGTGCTATTCAGATCATCTTATTGATGGTTGTTGCCGCTATTACGGGGATTGGGAGTGTGCTTGATGAAGCGCAAACGCACCGTCCTTTAGTGGCATGTACGTTAGTTGGTCTGATTTTAGGGGATTTACAAACAGGTATTATTCTTGGCGGGACGTTAGAAATGATGGCCTTGGGATGGATGAAC...GTTGGTCTGGCAATGGCACCAGATACTGCGATTGCATCAGTAATTTCAACCATCTTAGTGATTACAGCGCATCAAGGA.........------CTTGGTGAAGGAATTGCGATTGCAGTGCCTTTAGCAGCTGCTGGTCAAGCTTTAACCATTTTTGTTCGGACAATTACGGTC...TTCTTTGTTCATAAAGCAGATGATTACGCGAAGAACGGAAACTTCAAGGGGATAGAGCGAATGCATATTCTAGCCTTAGTTTTCCAAGCACTCCGTGTAATGATTCCAACATTGATTATTTGCCTAATTAGT---GCAAGTGCTGTGAGCCACTTCTTAAATGGTATTCCAGAAGTAATTACTGGCGGATTGCAAATCGGTGGTGGCATTATCGTTGTTGTTGGATATGCCATGGTCATTAATATGATGGATGTGCCATATCTTAAACCATTCTTCTACATGGGCTTCTTATTCGCAGCCTTCACAAACTTTAAT...TTGGTTGGTTTCGGAGGATTAGGGCTATGTTTAGCACTATTATTC
TRN  10010101100011000
NAM  Q9CEX7_LACLA/3-242
ASQ  YGVLSVILVIVVAFLAGLEGILDQWQFHQPIIACSLIGIVTGHASAGIILGGSLQLIALGWAN.VGAAVAPDAALASIASSILMVQSNNFdltHIMGTIVPAAILLATAGLVLTTLVRMLSV.VLVHQADRAAENGSYSGVEMWHFIALICQGLRIAIPAGLLLVIS-PDAIQKALAAIPPVISGGLAVGGGMVVAVGYAMVINLMATREVWPFFFLGFALAPISELT.LIATGVLGVVIAIVY
DSQ  TACGGTGTTTTATCTGTAATCTTGGTCATTGTTGTTGCCTTCCTTGCTGGTCTTGAAGGTATCCTTGACCAATGGCAATTCCACCAACCAATTATCGCCTGCTCGCTCATCGGTATTGTTACCGGTCATGCTTCTGCAGGGATTATCCTCGGTGGTTCACTTCAATTGATCGCTCTTGGTTGGGCTAAC...GTTGGTGCCGCTGTCGCACCCGATGCTGCCCTTGCCTCTATCGCATCATCTATCTTGATGGTTCAATCAAATAACTTTgacttgactCACATCATGGGTACTATCGTTCCTGCTGCTATCTTGCTTGCAACTGCTGGTCTTGTATTGACTACTCTTGTACGTATGCTTTCAGTT...GTGCTCGTTCACCAAGCTGACCGTGCTGCTGAAAATGGTTCATACTCAGGTGTTGAAATGTGGCACTTCATCGCGCTTATCTGTCAAGGTTTGCGTATTGCTATCCCTGCTGGACTTCTTTTGGTTATCTCA---CCAGATGCTATCCAAAAAGCACTTGCTGCTATTCCTCCAGTTATCTCTGGCGGTCTTGCTGTCGGTGGTGGGATGGTTGTTGCCGTTGGTTATGCAATGGTTATCAACCTTATGGCTACTCGTGAAGTATGGCCATTCTTCTTCCTTGGTTTCGCTCTCGCACCAATCTCTGAATTAACA...TTGATTGCAACTGGTGTCCTCGGTGTTGTTATCGCTATCGTTTAC
TRN  11011101111011000
NAM  Q99YE5_STRPY/4-242
ASQ  ISIISAILVVIIAFFAGLEGILDQFQMHQPLVACTLIGLVTGHLEAGVILGGTLQMLALGWAN.IGAAVAPDAALASVAAAIIMVKSGDFt.qKGITFAYSTAIPLAVAGLFLTMIVRTLST.ALVHAGDKAAAEGNFAGIERFHFIALLLQGLRIAVPAALLVAVP-TSAVQSVLNAMPNWLNEGMQIGGAMVVAVGYAMVINMMATREVWPFFALGFALAAISQLT.LIAMGVIGVAIAFIY
DSQ  ATTTCGATTATTTCTGCAATTTTGGTCGTTATCATTGCCTTCTTCGCTGGTCTTGAAGGTATCCTCGACCAATTTCAAATGCACCAACCACTTGTTGCCTGTACTTTGATTGGACTTGTAACTGGACACCTTGAAGCTGGTGTCATCCTTGGTGGTACACTTCAAATGCTTGCTCTTGGTTGGGCAAAC...ATCGGTGCTGCCGTTGCCCCTGATGCTGCCCTTGCCTCTGTTGCAGCTGCTATCATCATGGTCAAAAGTGGCGACTTTact...caaAAAGGAATTACCTTTGCTTACTCAACAGCTATCCCACTTGCTGTTGCTGGTCTTTTCCTTACAATGATCGTTCGTACTTTGTCAACT...GCCCTTGTACACGCTGGTGACAAAGCTGCCGCTGAAGGTAATTTCGCAGGTATTGAACGCTTCCACTTTATTGCCCTTCTTCTTCAAGGATTGCGTATCGCTGTCCCTGCAGCTCTTCTTGTTGCTGTTCCT---ACTTCAGCCGTACAATCTGTTTTGAATGCTATGCCAAACTGGTTGAACGAAGGTATGCAAATCGGTGGTGCGATGGTTGTTGCTGTAGGTTATGCTATGGTTATCAACATGATGGCTACTCGTGAAGTATGGCCATTCTTCGCCCTAGGTTTTGCTCTTGCAGCTATCAGCCAATTAACC...CTTATCGCTATGGGTGTTATCGGTGTAGCAATTGCCTTCATCTAC
TRN  11011101111011000
NAM  Q9S4L4_STRSL/4-242
ASQ  MSIISAILVVVVAFLAGLEGILDQFQFHQPLVACTLIGAATGNLTAGIMLGGSLQMIALAWAN.IGAAVAPDAALASVAAAIILVKGGNFt.tEGIGVATATAIPLAVAGLFLTMLVRTASV.ALVHAADKAAESGNIAGVERAHYLALLLQGLRIAVPAALLLAIP-AESVQHALGLMPSWLNHGMVVGGGMVVAVGYAMVINMMATREVWPFFAIGFAFAAISQLT.LIALGAIGVAIAFIY
DSQ  ATGTCAATTATTTCTGCAATTTTGGTCGTAGTTGTTGCCTTCCTTGCTGGTCTTGAAGGTATCCTTGACCAATTCCAATTCCACCAACCACTTGTTGCATGTACCCTCATCGGTGCTGCTACAGGTAACCTCACTGCAGGTATCATGCTTGGTGGTTCTCTTCAAATGATCGCCCTTGCTTGGGCTAAT...ATCGGTGCCGCTGTCGCTCCTGACGCTGCCCTTGCCTCTGTTGCTGCTGCCATTATTTTGGTTAAAGGTGGTAACTTCaca...actGAAGGTATCGGTGTTGCGACTGCAACAGCTATCCCACTTGCGGTTGCCGGTCTCTTCCTAACTATGCTTGTTCGTACAGCCTCTGTT...GCCCTTGTTCATGCCGCAGATAAAGCTGCAGAAAGTGGAAACATTGCTGGTGTTGAACGTGCACACTACCTCGCCCTCCTTCTTCAAGGGTTGCGTATCGCTGTGCCAGCCGCCCTTCTTCTTGCTATCCCA---GCAGAATCTGTTCAACATGCCCTTGGTTTGATGCCTAGCTGGCTCAACCACGGTATGGTTGTCGGTGGTGGTATGGTCGTAGCCGTTGGTTACGCTATGGTTATCAACATGATGGCAACTCGTGAAGTTTGGCCATTCTTCGCCATCGGTTTTGCTTTTGCTGCTATTAGCCAATTGACA...CTTATCGCTCTTGGTGCTATCGGTGTCGCTATTGCCTTCATCTAC
TRN  11011101111011001
NAM  Q97SP3_STRPN/1-239
ASQ  MSIISMVLVVVVAFFAGLEGILDQFQFHQPLVACTLIGLVTGHLEAGIILGGSLQMIALGWSN.IGAAIAPDAALASVAAAIIMVLGGDFt.kTGIGVAQAVAIPLAVAGLFLTMIVRTISV.GLVHTADAAAKKGDFGAVERAHFIALLFQGLRIALPAALLLMVP-TETVQSILSAMPDWLKDGMAIGGGMVVAVGYAMVINMMATREVWPFFALGFVLAAVSDIT.LIGFGAIGVAIALIY
DSQ  ATGTCTATTATTTCTATGGTTTTAGTAGTCGTTGTAGCCTTCTTTGCAGGTCTTGAAGGCATCCTCGACCAGTTCCAATTTCACCAACCACTTGTAGCCTGTACCCTTATTGGGCTTGTAACAGGTCACTTGGAAGCAGGGATTATCCTCGGTGGATCGCTTCAAATGATTGCCCTTGGTTGGTCAAAT...ATCGGTGCTGCTATCGCTCCTGATGCTGCACTTGCTTCTGTCGCTGCTGCCATTATCATGGTTCTTGGTGGTGACTTTacc...aagACTGGTATCGGTGTTGCCCAAGCGGTTGCTATCCCTCTTGCTGTAGCTGGACTTTTCTTGACAATGATTGTTCGTACAATTTCAGTT...GGTTTGGTTCATACTGCAGATGCTGCCGCTAAAAAAGGTGACTTCGGCGCTGTGGAGCGTGCGCATTTCATCGCGCTACTTTTCCAAGGACTTCGTATCGCGCTTCCTGCAGCTCTTCTCCTTATGGTACCA---ACTGAAACTGTACAAAGTATCCTTAGTGCCATGCCAGACTGGCTCAAAGATGGTATGGCTATCGGTGGTGGTATGGTCGTTGCCGTTGGTTACGCCATGGTTATCAACATGATGGCAACTCGTGAAGTATGGCCATTCTTCGCTCTTGGTTTCGTTCTCGCTGCTGTGTCAGATATTACT...CTAATCGGATTCGGTGCTATCGGCGTTGCTATCGCTCTTATCTAC
TRN  11011101111011000
NAM  Q97TN1_CLOAB/3-240
ASQ  LNIIQMGLVVIVAFLAGMEGILDEFHFHQPVIACTLIGLVTGNLVPCLILGGTLQMIALGWAN.IGAAVAPDAALASVASAIILVLGGQG..kAGVSSAIAIAVPLAVAGLLLQTICRTIGI.IIIHRMDAAAEEGNIRKIEMWHIIAICMQGVRIAIPAALILAIG-AGPIRSLLQAMPLWLTDGLAIGGGMVVAVGYAMVINMMATKEVWPFFAIGFVLATVSQIT.LIGLGAIGLALALLY
DSQ  CTAAATATAATTCAAATGGGATTAGTAGTTATTGTAGCGTTTCTAGCTGGTATGGAAGGTATATTGGACGAATTCCATTTCCATCAACCAGTAATTGCTTGTACTTTAATCGGATTAGTTACAGGTAACTTAGTACCTTGCTTAATATTAGGTGGTACTCTTCAAATGATTGCCTTAGGTTGGGCAAAT...ATAGGTGCTGCTGTAGCGCCTGATGCAGCTTTAGCATCTGTTGCATCCGCAATTATTTTAGTTCTTGGAGGACAAGGA......aaaGCAGGAGTTTCTTCAGCTATTGCTATTGCTGTTCCACTAGCAGTTGCAGGGCTATTATTACAAACTATTTGTCGTACAATTGGTATA...ATCATTATACATCGTATGGATGCTGCTGCTGAAGAAGGAAATATAAGAAAAATTGAAATGTGGCATATTATTGCTATTTGCATGCAGGGTGTACGTATTGCAATTCCAGCAGCTTTGATTTTAGCAATTGGT---GCTGGTCCTATTCGTTCATTACTTCAAGCTATGCCTCTTTGGTTGACAGATGGTTTAGCAATAGGTGGTGGAATGGTTGTAGCTGTTGGTTATGCAATGGTAATCAATATGATGGCTACAAAAGAAGTATGGCCATTCTTCGCAATTGGTTTTGTGTTAGCAACAGTTTCACAAATTACA...CTTATCGGACTAGGTGCAATTGGTTTAGCTTTAGCTCTTCTTTAC
TRN  10010101110011000
NAM  Q97N93_STRPN/1-235
ASQ  MLFTQALLVTLVGIIATIDYNGPLFMIHRPLVTSAMVGLVLGDFTQGVLIGSALELTWLGVTG.IGGYTPPDTISGAIIGTAFGILSGQG...--ETAGIAIAVPIAVATQQLDVLAKTLDV.YFVKKADNDAKNGDYSKIGFYHYSSLVLITL-FKIVPIFLAIMLGGEYVADLFAKVPPIVMQGLNSAGALLPSIGFGMLLNMMLKKNMWVFLLIGFICSVYGGMS.TIGISLVGIAVAYFY
DSQ  ATGCTATTCACACAAGCATTACTGGTGACATTAGTTGGGATTATTGCCACTATTGACTATAATGGACCGTTATTTATGATTCACCGTCCGTTAGTTACAAGTGCAATGGTTGGCTTAGTATTAGGAGATTTCACCCAAGGTGTTCTTATTGGTTCAGCTCTTGAATTAACTTGGCTCGGTGTAACAGGT...ATTGGAGGTTATACTCCACCAGATACTATTTCAGGTGCGATTATTGGTACTGCATTTGGTATTTTATCTGGTCAAGGA.........------GAAACTGCTGGTATCGCTATAGCAGTTCCAATTGCAGTTGCTACCCAACAGTTGGATGTTCTTGCAAAAACTTTAGATGTT...TATTTTGTGAAAAAAGCTGATAATGATGCTAAAAACGGAGATTATTCAAAGATCGGTTTTTATCATTATTCAAGTTTGGTTTTAATCACGTTA---TTTAAAATTGTACCAATTTTCCTAGCTATTATGCTTGGAGGGGAATATGTGGCAGACTTGTTTGCTAAGGTTCCACCAATCGTTATGCAGGGACTTAACTCTGCAGGTGCTTTACTACCTTCAATTGGTTTTGGTATGCTTTTAAATATGATGCTCAAGAAAAATATGTGGGTATTCTTGTTGATTGGATTCATTTGTTCTGTGTATGGAGGAATGTCA...ACCATTGGGATCTCACTAGTTGGTATTGCGGTAGCATACTTCTAC
TRN  10010101100011000
NAM  Q97SK8_STRPN/3-238
ASQ  INVFQAILIGLWTAFCFSGMLLG-IYTNRCIVLSFGVGIILGDLPTALAMGAIGELAYMGFGVgAGGTVPPNPIGPGIFGTLMAITSAGK...VSPEAALALSTPIAVAIQFLQTFAYTVRA.GAPETAMKHLKNHNLKKFKFTLNATIWLFAF-IGFTLGCLG-ALSMDTLLKLVDYIPPVLLTGLTVAGKMLPAIGFAMILSVMAKKELIPFVLLGYVCAAYLNIP.TIGIAIVGTIFALIE
DSQ  ATTAATGTATTTCAAGCGATTTTAATTGGATTATGGACAGCTTTCTGTTTTAGTGGAATGCTGTTAGGA---ATTTACACCAATAGATGTATTGTTCTGTCATTTGGTGTCGGAATTATTCTAGGTGATCTGCCTACTGCTCTTGCAATGGGAGCTATTGGTGAATTGGCTTATATGGGATTCGGTGTTggtGCTGGAGGTACTGTTCCACCAAACCCAATCGGACCTGGTATCTTTGGTACCTTGATGGCTATCACTAGTGCTGGTAAA.........GTCAGTCCAGAAGCGGCTCTTGCCCTCTCTACTCCGATTGCTGTGGCGATTCAATTCTTACAAACTTTCGCCTACACTGTACGTGCT...GGTGCGCCTGAAACAGCTATGAAGCACTTGAAAAACCATAATTTGAAGAAATTTAAGTTCACTCTAAATGCAACAATTTGGTTGTTTGCCTTT---ATTGGATTTACCTTGGGTTGCTTGGGT---GCCCTTTCAATGGATACCTTGTTGAAACTCGTAGACTACATTCCACCGGTATTACTTACAGGTTTGACAGTTGCTGGTAAAATGCTCCCAGCTATCGGTTTTGCGATGATCTTGTCAGTGATGGCTAAGAAAGAGTTGATTCCCTTTGTCTTGTTGGGATATGTTTGTGCAGCTTATCTAAACATCCCA...ACAATTGGTATTGCAATTGTAGGTACTATCTTTGCTTTGATTGAA
TRN  10010101100011000
NAM  P96163_VIBFU/3-237
ASQ  IGLFQALMLGLLAFLAGLDLFNGLTHFHRPVVLGPLVGLILGDLHTGILVGGTLELIWMGLAP.LAGAQPPNVIIGTIVGTTFAITTN--...VEPNVAVGVAVPFAVAVQMGITLLFSAMS.AVMSKCDEYAKNADTRGIERVNYFALAVLGS-FYFLCAFLPIYLGADHAGAMVAALPKALIDGLGVAGGIMPAIGFAVLMKIMMKNAYIPYFILGFVAAAWLQLP.ILAIRCAATAMAIID
DSQ  ATAGGACTCTTTCAGGCGTTGATGTTGGGCCTACTGGCCTTCTTGGCCGGTCTTGACCTCTTCAATGGCCTGACTCACTTTCACCGGCCGGTGGTCTTAGGACCGTTGGTTGGCCTGATTCTCGGTGATTTACACACCGGGATTTTGGTCGGCGGAACGTTAGAACTGATCTGGATGGGGCTTGCGCCA...CTGGCTGGCGCGCAGCCGCCCAATGTCATCATTGGCACCATCGTGGGCACCACTTTCGCTATCACGACCAAC------.........GTGGAACCAAACGTTGCAGTTGGGGTTGCCGTTCCCTTTGCGGTCGCGGTTCAGATGGGCATCACCTTACTGTTCTCCGCCATGTCA...GCGGTGATGTCGAAGTGCGATGAATACGCCAAGAATGCCGATACTCGTGGCATTGAACGAGTGAACTATTTCGCGCTGGCGGTGTTGGGGAGT---TTTTACTTCTTGTGTGCTTTTTTGCCCATCTATCTGGGGGCTGACCATGCAGGTGCGATGGTTGCGGCGCTCCCGAAAGCATTGATTGATGGCCTAGGGGTTGCGGGGGGCATTATGCCGGCGATTGGGTTTGCCGTGCTGATGAAAATCATGATGAAGAATGCCTATATTCCGTACTTCATCTTAGGGTTTGTCGCCGCCGCTTGGCTTCAATTACCC...ATTTTGGCAATTCGTTGCGCCGCCACTGCGATGGCCATTATCGAT
TRN  10010101100011000
NAM  Q9KIQ3_ECOLI/3-237
ASQ  ISLLQAFALGIIAFIAGLDMFNGLTHMHRPVVLGPLVGLVLGDLHTGILTGGTLELVWMGLAP.LAGAQPPNVIIGTIVGTAFAITTG--...VKPDVAVGVAVPFAVAVQMGITFLFSVMS.GVMSRCARMPRTPILAALNACNYLALLALGN-FYFLCAFLPIYFGAEHAKTIIDVLPQRLIDGLGVAGGIMPAIGFAVLLKIMMKNVYIPYFILGFVAAAWLKLP.VLAIACPALAMALID
DSQ  ATCAGCCTGTTGCAGGCATTTGCGTTGGGCATTATCGCCTTTATCGCTGGCCTGGATATGTTTAACGGCCTAACCCATATGCACCGCCCGGTGGTCCTCGGCCCGTTGGTCGGGCTGGTACTTGGCGATCTGCATACCGGAATTTTAACCGGCGGTACGCTGGAACTGGTGTGGATGGGGCTGGCCCCG...CTGGCGGGCGCACAGCCGCCTAACGTGATTATCGGTACTATCGTCGGCACGGCGTTTGCCATTACTACTGGC------.........GTGAAACCCGATGTCGCAGTAGGTGTCGCCGTACCTTTCGCTGTCGCAGTACAGATGGGGATTACCTTCCTGTTCTCGGTGATGTCC...GGCGTGATGTCTCGCTGCGCCCGGATGCCGAGAACGCCGATACTCGCGGCATTGAACGCGTGTAACTATCTGGCACTGCTGGCACTCGGCAAT---TTCTATTTTCTCTGCGCTTTCCTGCCTATCTACTTCGGGGCGGAACATGCAAAAACCATCATTGATGTCCTGCCGCAACGATTAATCGACGGCCTCGGCGTTGCGGGCGGCATCATGCCAGCAATCGGTTTTGCCGTGCTGCTGAAAATCATGATGAAAAACGTCTACATCCCCTACTTCATCCTGGGCTTTGTTGCCGCCGCCTGGCTCAAGTTACCA...GTGCTGGCTATTGCATGCCCTGCGCTTGCGATGGCGCTTATCGAC
TRN  10010101100011010
NAM  Q9KIP7_ECOLI/4-239
ASQ  ITLLQGLSLAALVFVLGIDFWLEALFLFRPIIVCTLTGAILGDIQTGLITGGLTELAFAGLTP.AGGVQAPNPIMAGLMTTVIAWSTG--...VDAKTAIGLGLPFSLLMQYVILFFYSAFS.LFMTKADKCAKEADTAAFSRLNWTTMLIVAS-AYAVIAFLCTYLAQGAMQALVKAMPAWLTHGFEVAGGILPAVGFGLLLRVMFKAQYIPYLIAGFLFVCYIQVSnLLPVAVLGAGFAVYE
DSQ  ATAACCCTACTTCAGGGATTATCCCTGGCGGCGTTAGTTTTTGTTCTGGGGATTGATTTTTGGCTGGAAGCCTTATTTTTATTCCGCCCGATAATCGTTTGTACCCTAACTGGCGCTATTCTCGGTGATATTCAGACTGGCTTAATTACCGGTGGTCTGACAGAGTTGGCTTTCGCCGGATTAACCCCT...GCAGGTGGTGTTCAGGCGCCCAACCCGATTATGGCGGGTCTGATGACCACCGTCATTGCATGGTCTACGGGC------.........GTTGATGCCAAAACAGCAATTGGTCTTGGCCTGCCGTTTAGTTTGTTAATGCAGTACGTCATTCTGTTCTTCTATTCCGCTTTCTCA...TTATTTATGACCAAAGCCGATAAATGCGCGAAAGAGGCGGATACGGCAGCGTTTTCCCGGCTTAACTGGACAACGATGCTCATCGTCGCTTCA---GCGTATGCGGTGATTGCTTTCCTCTGTACTTACCTGGCACAGGGGGCGATGCAGGCGCTGGTGAAAGCGATGCCCGCCTGGCTGACCCACGGCTTTGAAGTGGCTGGCGGTATTCTGCCTGCCGTTGGTTTTGGCTTGCTGCTGCGCGTAATGTTCAAAGCGCAATATATCCCTTACCTGATCGCCGGTTTCCTGTTTGTTTGCTACATCCAGGTCAGCaacCTGTTGCCGGTTGCCGTACTGGGCGCAGGCTTTGCGGTGTATGAG
TRN  10010101100011000
NAM  Q99ZV2_STRPY/1-230
ASQ  ------MAALAVLICFGGNYLTGQSMMERPLVVGLVTGLLLGDMKVGILMGASLEALFLGNVN.IGGVIAAEPVTATAMATTFTIISHID...--QKAAMTLAVPIGMLAAFVVMFLKNVFMnIFAPMVDKAAAANHQGKLVMLHYGTWIIYYL-IIASISFIGILVGSGPVNAFVEHIPQNLMNGLSAAGGLLPAVGFAMLMKLLWTNKLAVFYLLGFVLTAYLKLP.AVAVAALGAVICVIS
DSQ  ------------------ATGGCAGCTTTAGCTGTATTGATTTGTTTTGGGGGAAATTATTTAACCGGTCAAAGCATGATGGAAAGACCCCTAGTAGTTGGACTGGTCACAGGTCTTCTTTTAGGAGATATGAAGGTCGGTATCTTAATGGGGGCCTCTCTAGAAGCTCTTTTCCTAGGAAATGTGAAT...ATTGGGGGTGTTATTGCAGCTGAGCCTGTAACAGCGACTGCCATGGCAACAACCTTTACCATTATTTCACATATTGAC.........------CAAAAAGCAGCCATGACCCTAGCTGTTCCAATTGGAATGTTGGCAGCCTTTGTGGTTATGTTTTTGAAAAACGTCTTCATGaatATCTTTGCTCCAATGGTTGATAAAGCTGCAGCAGCTAACCATCAAGGTAAACTAGTGATGCTCCACTATGGCACTTGGATTATCTATTACTTA---ATCATTGCCTCTATTTCTTTCATTGGTATCTTAGTAGGTAGTGGACCTGTTAATGCCTTTGTGGAACACATTCCTCAAAATCTCATGAATGGCTTGAGTGCTGCGGGAGGCCTTCTTCCAGCTGTCGGTTTTGCCATGCTGATGAAATTATTGTGGACCAACAAATTAGCTGTTTTTTACCTATTGGGCTTTGTCTTAACAGCTTATTTGAAATTACCA...GCGGTTGCAGTTGCTGCCCTAGGAGCAGTTATTTGCGTCATTAGT
TRN  10010101100011000
//