EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03555 - Flu_C_NS2)
FAM  PF03555
PID  Flu_C_NS2
DES  Influenza C non-structural protein (NS2)
IPR  IPR005188
ANO  2
ALN  57
AID  0.946429
APH  (Q9ENX5_9ORTO/6-62:0.02367,Q9ENY6_9ORTO/6-62:0.03000);
ATP  (Q9ENX5_9ORTO/6-62,Q9ENY6_9ORTO/6-62);
ATL  0.05367
DNO  2
DLN  171
DID  0.953216
DPH  (Q9ENX5_9ORTO/6-62:0.00000,Q9ENY6_9ORTO/6-62:0.04961);
DTP  (Q9ENX5_9ORTO/6-62,Q9ENY6_9ORTO/6-62);
DTL  0.04961
RID  0.946429
RPH  (Q9ENX5_9ORTO/6-62:0.02367,Q9ENY6_9ORTO/6-62:0.03000);
RTP  (Q9ENX5_9ORTO/6-62,Q9ENY6_9ORTO/6-62);
RTL  0.05367
LNK  Q9ENX5_9ORTO/6-62:Q9ENX5:AB034171
LNK  Q9ENY6_9ORTO/6-62:Q9ENY6:AB034161
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9ENX5_9ORTO/6-62
ASQ  VKSTNLMAFVATKMLERQEDLDTCTEMQVEKMKASTKARLKTESSFAPRTWEDAIKD
DSQ  GTCAAATCAACAAATTTAATGGCATTTGTAGCCACAAAAATGTTAGAGAGACAAGAAGATTTAGACACATGCACTGAAATGCAAGTAGAAAAAATGAAAGCGTCAACAAAAGCTAGGTTGAAAACAGAATCTTCTTTTGCACCTAGAACGTGGGAAGATGCAATAAAAGAT
TRN  10010101110011000
NAM  Q9ENY6_9ORTO/6-62
ASQ  VKSTNLMAFVATKMLERQEDLDTCTEMQIEKMKTSTKARLRTESSFAPRTWEDAIKD
DSQ  GTCAAATCAACAAATTTAATGGCATTTGTAGCCACAAAAATGTTAGAGAGACAAGAAGATTTAGACACATGCACTGAAATGCAAATAGAAAAAATGAAAACATCAACAAAAGCCAGGCTGAGAACAGAATCCTCTTTTGCACCTAGAACATGGGAAGATGCAATAAAAGAT
TRN  10010101100011000
//