EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03510 - Peptidase_C24)
FAM  PF03510
PID  Peptidase_C24
DES  2C endopeptidase (C24) cysteine protease family
IPR  IPR000317
ANO  5
ALN  107
AID  0.305944
APH  (Q9QEJ5_9CALI/1063-1169:0.65162,(Q86114_RHDV/1120-1218:0.78739,(Q9QRV9_9CALI/1095-1199:0.44334,O92368_9CALI/1208-1312:0.36957):0.57825):0.96697,POLN_MANCV/997-1103:0.35797);
ATP  (Q9QEJ5_9CALI/1063-1169,(Q86114_RHDV/1120-1218,(Q9QRV9_9CALI/1095-1199,O92368_9CALI/1208-1312)),POLN_MANCV/997-1103);
ATL  4.15517
DNO  4
DLN  321
DID  0.41172
DPH  ((Q9QRV9_9CALI/1095-1199:0.29088,O92368_9CALI/1208-1312:0.41929):0.29971,Q86114_RHDV/1120-1218:0.61299,Q9QEJ5_9CALI/1063-1169:0.77407);
DTP  ((Q9QRV9_9CALI/1095-1199,O92368_9CALI/1208-1312),Q86114_RHDV/1120-1218,Q9QEJ5_9CALI/1063-1169);
DTL  2.39694
RID  0.301644
RPH  ((Q9QRV9_9CALI/1095-1199:0.41725,O92368_9CALI/1208-1312:0.39210):0.45452,Q86114_RHDV/1120-1218:0.92108,Q9QEJ5_9CALI/1063-1169:1.50737);
RTP  ((Q9QRV9_9CALI/1095-1199,O92368_9CALI/1208-1312),Q86114_RHDV/1120-1218,Q9QEJ5_9CALI/1063-1169);
RTL  3.69233
LNK  O92368_9CALI/1208-1312:O92368:AF091736
LNK  POLN_MANCV/997-1103:Q69014:
LNK  Q86114_RHDV/1120-1218:Q86114:U54983
LNK  Q9QEJ5_9CALI/1063-1169:Q9QEJ5:AF182760
LNK  Q9QRV9_9CALI/1095-1199:Q9QRV9:AF109465
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  POLN_MANCV/997-1103
ASQ  GYGVHIGNGNVITVTHVASTSDEVNGSAFKITRTVGETTWVQGPFSQLPHMQIGSGSPVYFTTRLHPVFTISEGTFETPNITVNGFHVRIMNGYPTKKGDCGLPYFN
NAM  Q9QEJ5_9CALI/1063-1169
ASQ  GWAVHIGNGRLVTCTHVANMCDRVAEVEFKVAETDRDTCIITAPLGHLPSVALGNGPPAFYTTNFHPIRVLDEGSWDTTTTRVTGWRVVINNGTTTAPGDCGQPYLN
DSQ  GGTTGGGCGGTCCACATCGGGAATGGGCGCCTGGTCACTTGCACGCATGTGGCCAACATGTGTGACCGTGTAGCCGAGGTGGAGTTCAAGGTCGCAGAAACAGACCGCGACACCTGCATCATCACTGCCCCCCTCGGCCACCTGCCTAGCGTTGCGCTTGGTAATGGGCCACCAGCATTTTACACAACCAACTTCCACCCCATCCGGGTGCTGGATGAGGGCAGCTGGGACACCACAACCACCCGTGTGACAGGGTGGCGCGTGGTCATCAACAATGGCACAACAACGGCCCCAGGCGACTGCGGTCAACCCTATCTCAAT
TRN  11011111101111111
NAM  Q86114_RHDV/1120-1218
ASQ  GRMIHIGNGLYISNTHTARSS----CSEIVTCSPTTDLCLVKGEAIR-SVAQIAEGTPVCDWKKSPISTYGIKKTLSDST-KIDVLAYDGCT--QTTHGDCGLPLYD
DSQ  GGTCGGATGATCCACATAGGCAACGGGTTGTACATTTCCAACACTCACACCGCCAGGTCAAGC------------TGCTCAGAAATTGTCACATGCTCACCCACCACTGACCTGTGCCTCGTCAAGGGTGAGGCAATCCGC---AGTGTTGCTCAGATCGCTGAAGGTACCCCAGTTTGTGACTGGAAGAAGTCTCCAATTTCAACCTATGGCATCAAGAAGACATTGTCAGACTCCACA---AAGATTGACGTGCTGGCGTATGACGGTTGCACA------CAGACCACCCACGGGGACTGTGGGCTGCCGCTGTATGAC
TRN  10010101100011001
NAM  Q9QRV9_9CALI/1095-1199
ASQ  GYCVHMGHGVYASVAHVVKGDSFFLGERIFDIKSNGEFCCFRSTKILPSAAPFFSGKPTRDPWGSPVATEWKPKPYTTTSGKIVGCFATTST--ETHPGDCGLPYID
DSQ  GGTTACTGCGTCCACATGGGACATGGAGTGTATGCCTCCGTAGCCCATGTTGTGAAGGGTGACTCTTTCTTTCTTGGAGAAAGGATCTTCGACATAAAATCAAATGGTGAATTTTGTTGCTTTCGTAGCACCAAAATTCTGCCTAGTGCTGCACCTTTCTTCTCGGGAAAGCCTACACGGGATCCGTGGGGTTCTCCCGTTGCCACAGAATGGAAACCTAAACCATATACCACCACATCTGGTAAAATTGTGGGATGTTTCGCTACAACATCTACC------GAAACTCATCCTGGAGATTGTGGCCTCCCATACATTGAT
TRN  10010101100011001
NAM  O92368_9CALI/1208-1312
ASQ  GYAIHIGHGVYISLKHVVSGNAKILSEDPKDLKINGELATFRLNSILPTAVPVGTSKPIKDPWGNPVSTDWQFRNYNTTSGSIYGACGSSCS--LTRQGDCGLPYVD
DSQ  GGGTACGCAATCCACATTGGTCATGGAGTTTACATTTCACTGAAGCATGTGGTGTCAGGAAATGCCAAAATCTTATCAGAAGATCCAAAAGACCTAAAGATCAATGGTGAATTGGCAACTTTCAGATTGAACAGCATACTCCCTACGGCTGTGCCGGTTGGGACGTCCAAACCCATCAAAGACCCGTGGGGGAACCCGGTCTCAACGGATTGGCAGTTCAGAAACTACAACACAACCTCTGGAAGCATCTATGGAGCTTGCGGCTCATCATGTTCT------TTGACACGACAGGGCGACTGCGGTCTCCCATACGTTGAT
TRN  10010101100011000
//