EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03504 - Chlam_OMP6)
FAM  PF03504
PID  Chlam_OMP6
DES  Chlamydia cysteine-rich outer membrane protein 6
IPR  IPR003506
ANO  2
ALN  95
AID  0.782609
APH  (Q9AF83_9CHLA/88-182:0.13264,OM6D_CHLTR/88-182:0.11774);
ATP  (Q9AF83_9CHLA/88-182,OM6D_CHLTR/88-182);
ATL  0.25038
DNO  2
DLN  285
DID  0.761404
DPH  (Q9AF83_9CHLA/88-182:0.27672,OM6D_CHLTR/88-182:0.01900);
DTP  (Q9AF83_9CHLA/88-182,OM6D_CHLTR/88-182);
DTL  0.29572
RID  0.782609
RPH  (Q9AF83_9CHLA/88-182:0.06774,OM6D_CHLTR/88-182:0.18264);
RTP  (Q9AF83_9CHLA/88-182,OM6D_CHLTR/88-182);
RTL  0.25037
LNK  OM6D_CHLTR/88-182:P18151:X53510
LNK  Q9AF83_9CHLA/88-182:Q9AF83:AF367407
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9AF83_9CHLA/88-182
ASQ  CYGKMYSVRVNDDCNVEISQAVPEYATVGSPYPIEILAVGKKDCVNVVITQQLPCEVEFVSSDPVTTPTSDSKLIWTIDRLGQGERCKITGWVKP
DSQ  TGCTACGGCAAAATGTATAGTGTTCGTGTTAACGATGATTGTAACGTTGAAATTAGCCAAGCTGTACCTGAATATGCAACAGTAGGATCTCCTTATCCTATTGAAATTCTTGCAGTAGGTAAAAAAGATTGCGTTAATGTCGTTATCACTCAACAGCTTCCTTGCGAAGTAGAATTTGTCAGCAGTGATCCTGTGACAACACCTACCTCCGATAGCAAATTAATTTGGACTATAGATCGCTTAGGTCAAGGTGAAAGATGCAAAATTACCGGTTGGGTAAAACCT
TRN  10010101110011010
NAM  OM6D_CHLTR/88-182
ASQ  CFGRMYTVKVNDDRNVEITQAVPEYATVGSPYPIEITATGKRDCVDVIITQQLPCEAEFVRSDPATTPTADGKLVWKIDRLGQGEKSKITVWVKP
DSQ  TGCTTTGGCAGAATGTATACAGTCAAAGTTAATGATGATCGCAATGTTGAAATCACACAAGCTGTTCCTGAATATGCTACGGTAGGATCTCCCTATCCTATTGAAATTACTGCTACAGGTAAAAGGGATTGTGTTGATGTTATCATTACTCAGCAATTACCATGTGAAGCAGAGTTCGTACGCAGTGATCCAGCGACAACTCCTACTGCTGATGGTAAGCTAGTTTGGAAAATTGACCGCTTAGGACAAGGCGAAAAGAGTAAAATTACTGTATGGGTAAAACCT
TRN  10010101110011010
//