EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03448 - MgtE_N)
FAM  PF03448
PID  MgtE_N
DES  MgtE intracellular domain
IPR  IPR006668
ANO  51
ALN  135
AID  0.220676
APH  (((((Q8XKS1_CLOPE/162-290:0.30187,Q97L78_CLOAB/2-130:0.17161):0.62045,((((Q8ERS6_OCEIH/15-143:0.41917,(Q8CPS5_STAEP/15-145:0.09612,Q99V82_STAAM/15-145:0.26773):0.50176):0.32300,Q9K7Y3_BACHD/10-138:0.89808):0.47861,(O34442_BACSU/8-136:0.61226,Q9KFG8_BACHD/7-135:0.42543):0.33274):0.33041,(((O86315_MYCTU/159-287:0.54220,Q9FBK4_STRCO/155-283:0.38854):0.13302,Q8NRC7_CORGL/160-288:0.48597):0.35392,(O06312_MYCTU/7-136:1.55216,(((Q8PFA5_XANAC/1-125:0.55597,Q8UGN7_AGRT5/7-128:0.62378):0.14975,Q8FVG5_BRUSU/12-135:0.50870):0.10072,Q98MM2_RHILO/1-125:0.79279):0.39174):0.45163):0.16994):0.07380):0.03583,Q8XL02_CLOPE/7-129:1.02056):0.27437,((Q9PRD6_UREPA/19-147:1.22743,Q8EHS2_SHEON/11-139:0.89095):0.51236,((Q8RDN1_FUSNN/4-132:0.45475,(O83887_TREPA/2-130:0.54174,((O68316_VIBCH/17-133:2.38623,O50166_BORBU/1-129:0.18769):0.57659,Q895C8_CLOTE/5-133:0.31832):0.17802):0.08194):0.27731,(Q8KBD4_CHLTE/4-132:0.82716,((Q8PWC9_METMA/2-127:0.91763,((Q8NTS8_CORGL/8-136:0.50691,Q8FUE7_COREF/31-159:0.65905):0.72705,((P73368_SYNY3/19-147:0.27196,Q8YLW2_ANASP/21-149:0.32064):0.35117,Q8YWD1_ANASP/18-144:0.47652):0.07826):0.03665):0.20867,Q9X0P4_THEMA/3-131:0.53324):0.09977):0.05346):0.09900):0.23644):0.15469,((Q92H85_RICCN/19-147:1.26004,Q8A0H9_BACTN/3-133:0.52277):0.15199,(Q9A6C0_CAUCR/45-173:0.78923,(Q89JN2_BRAJA/30-158:0.31682,((Q8UF52_AGRT5/32-160:0.22519,Q92QC9_RHIME/31-159:0.10701):0.09174,Q98KU3_RHILO/28-156:0.15997):0.36067):0.51915):0.07837):0.33502,((O84197_CHLTR/14-143:1.80693,(Q8EGN5_SHEON/17-145:0.77280,(Q87GS5_VIBPA/8-137:0.11415,(Q9KLC8_VIBCH/8-137:0.20692,Q8D5W6_VIBVU/8-137:0.15929):0.03068):0.61529):0.51577):0.31990,(((Q8DE98_VIBVU/11-139:0.32990,(Q8EAE0_SHEON/12-140:0.12735,Q9S0K7_SHEVI/12-140:0.17972):0.20832):0.32045,Q8P704_XANCP/11-139:0.43603):0.13659,(Q8ZCW9_YERPE/50-178:0.73839,(Q9JWC7_NEIMA/43-171:0.46269,Q885I7_PSESM/39-167:0.37790):0.13749):0.33688):0.25406):0.11793);
ATP  (((((Q8XKS1_CLOPE/162-290,Q97L78_CLOAB/2-130),((((Q8ERS6_OCEIH/15-143,(Q8CPS5_STAEP/15-145,Q99V82_STAAM/15-145)),Q9K7Y3_BACHD/10-138),(O34442_BACSU/8-136,Q9KFG8_BACHD/7-135)),(((O86315_MYCTU/159-287,Q9FBK4_STRCO/155-283),Q8NRC7_CORGL/160-288),(O06312_MYCTU/7-136,(((Q8PFA5_XANAC/1-125,Q8UGN7_AGRT5/7-128),Q8FVG5_BRUSU/12-135),Q98MM2_RHILO/1-125))))),Q8XL02_CLOPE/7-129),((Q9PRD6_UREPA/19-147,Q8EHS2_SHEON/11-139),((Q8RDN1_FUSNN/4-132,(O83887_TREPA/2-130,((O68316_VIBCH/17-133,O50166_BORBU/1-129),Q895C8_CLOTE/5-133))),(Q8KBD4_CHLTE/4-132,((Q8PWC9_METMA/2-127,((Q8NTS8_CORGL/8-136,Q8FUE7_COREF/31-159),((P73368_SYNY3/19-147,Q8YLW2_ANASP/21-149),Q8YWD1_ANASP/18-144))),Q9X0P4_THEMA/3-131))))),((Q92H85_RICCN/19-147,Q8A0H9_BACTN/3-133),(Q9A6C0_CAUCR/45-173,(Q89JN2_BRAJA/30-158,((Q8UF52_AGRT5/32-160,Q92QC9_RHIME/31-159),Q98KU3_RHILO/28-156)))),((O84197_CHLTR/14-143,(Q8EGN5_SHEON/17-145,(Q87GS5_VIBPA/8-137,(Q9KLC8_VIBCH/8-137,Q8D5W6_VIBVU/8-137)))),(((Q8DE98_VIBVU/11-139,(Q8EAE0_SHEON/12-140,Q9S0K7_SHEVI/12-140)),Q8P704_XANCP/11-139),(Q8ZCW9_YERPE/50-178,(Q9JWC7_NEIMA/43-171,Q885I7_PSESM/39-167)))));
ATL  42.1996
DNO  50
DLN  405
DID  0.383638
DPH  (((((((((Q8ERS6_OCEIH/15-143:0.29431,(Q8CPS5_STAEP/15-145:0.11978,Q99V82_STAAM/15-145:0.17913):0.21581):0.08407,Q9K7Y3_BACHD/10-138:0.54639):0.22192,(Q8XL02_CLOPE/7-129:0.51165,(Q8XKS1_CLOPE/162-290:0.20713,Q97L78_CLOAB/2-130:0.19896):0.21607):0.06965):0.07171,((O34442_BACSU/8-136:0.40589,Q9KFG8_BACHD/7-135:0.33701):0.22533,Q92H85_RICCN/19-147:0.60377):0.04050):0.10276,(((Q895C8_CLOTE/5-133:0.24821,(Q8RDN1_FUSNN/4-132:0.29090,O83887_TREPA/2-130:0.47212):0.09024):0.12573,(((P73368_SYNY3/19-147:0.29731,Q8YLW2_ANASP/21-149:0.21573):0.18644,Q8YWD1_ANASP/18-144:0.40197):0.06861,(Q8PWC9_METMA/2-127:0.51218,(Q9X0P4_THEMA/3-131:0.37010,((Q8KBD4_CHLTE/4-132:0.37862,(((((Q885I7_PSESM/39-167:0.28346,(Q8ZCW9_YERPE/50-178:0.54559,Q9JWC7_NEIMA/43-171:0.29298):0.04430):0.21021,(Q8P704_XANCP/11-139:0.20351,(Q8DE98_VIBVU/11-139:0.22755,(Q8EAE0_SHEON/12-140:0.19856,Q9S0K7_SHEVI/12-140:0.18964):0.22671):0.26198):0.05556):0.18415,Q9A6C0_CAUCR/45-173:0.31058):0.08783,((O06312_MYCTU/7-136:0.58413,(Q89JN2_BRAJA/30-158:0.17479,((Q8UF52_AGRT5/32-160:0.18516,Q92QC9_RHIME/31-159:0.13742):0.05440,Q98KU3_RHILO/28-156:0.17257):0.20594):0.16936):0.07469,((Q9FBK4_STRCO/155-283:0.19824,(O86315_MYCTU/159-287:0.30338,Q8NRC7_CORGL/160-288:0.42984):0.07713):0.20614,((Q8PFA5_XANAC/1-125:0.32259,(Q8FVG5_BRUSU/12-135:0.34300,Q8UGN7_AGRT5/7-128:0.39098):0.11220):0.06577,Q98MM2_RHILO/1-125:0.47043):0.21575):0.06023):0.04751):0.07648,Q8A0H9_BACTN/3-133:0.44324):0.20426):0.11238,(Q8NTS8_CORGL/8-136:0.30682,Q8FUE7_COREF/31-159:0.47946):0.40366):0.07820):0.12784):0.08234):0.22652):0.03675,(O68316_VIBCH/17-133:1.08341,O84197_CHLTR/14-143:0.74762):0.02997):0.07032):0.10030,(Q8EHS2_SHEON/11-139:0.70751,Q9PRD6_UREPA/19-147:0.47505):0.04566):0.41808,Q8EGN5_SHEON/17-145:0.53449):0.26189,Q9KLC8_VIBCH/8-137:0.22253):0.06740,Q87GS5_VIBPA/8-137:0.19068,Q8D5W6_VIBVU/8-137:0.17207);
DTP  (((((((((Q8ERS6_OCEIH/15-143,(Q8CPS5_STAEP/15-145,Q99V82_STAAM/15-145)),Q9K7Y3_BACHD/10-138),(Q8XL02_CLOPE/7-129,(Q8XKS1_CLOPE/162-290,Q97L78_CLOAB/2-130))),((O34442_BACSU/8-136,Q9KFG8_BACHD/7-135),Q92H85_RICCN/19-147)),(((Q895C8_CLOTE/5-133,(Q8RDN1_FUSNN/4-132,O83887_TREPA/2-130)),(((P73368_SYNY3/19-147,Q8YLW2_ANASP/21-149),Q8YWD1_ANASP/18-144),(Q8PWC9_METMA/2-127,(Q9X0P4_THEMA/3-131,((Q8KBD4_CHLTE/4-132,(((((Q885I7_PSESM/39-167,(Q8ZCW9_YERPE/50-178,Q9JWC7_NEIMA/43-171)),(Q8P704_XANCP/11-139,(Q8DE98_VIBVU/11-139,(Q8EAE0_SHEON/12-140,Q9S0K7_SHEVI/12-140)))),Q9A6C0_CAUCR/45-173),((O06312_MYCTU/7-136,(Q89JN2_BRAJA/30-158,((Q8UF52_AGRT5/32-160,Q92QC9_RHIME/31-159),Q98KU3_RHILO/28-156))),((Q9FBK4_STRCO/155-283,(O86315_MYCTU/159-287,Q8NRC7_CORGL/160-288)),((Q8PFA5_XANAC/1-125,(Q8FVG5_BRUSU/12-135,Q8UGN7_AGRT5/7-128)),Q98MM2_RHILO/1-125)))),Q8A0H9_BACTN/3-133)),(Q8NTS8_CORGL/8-136,Q8FUE7_COREF/31-159)))))),(O68316_VIBCH/17-133,O84197_CHLTR/14-143))),(Q8EHS2_SHEON/11-139,Q9PRD6_UREPA/19-147)),Q8EGN5_SHEON/17-145),Q9KLC8_VIBCH/8-137),Q87GS5_VIBPA/8-137,Q8D5W6_VIBVU/8-137);
DTL  24.3781
RID  0.221056
RPH  ((((Q8EHS2_SHEON/11-139:0.92012,Q9PRD6_UREPA/19-147:1.21745):0.54378,((((Q8XL02_CLOPE/7-129:1.05305,((Q8XKS1_CLOPE/162-290:0.30132,Q97L78_CLOAB/2-130:0.17243):0.60440,((((Q8ERS6_OCEIH/15-143:0.40421,(Q8CPS5_STAEP/15-145:0.09686,Q99V82_STAAM/15-145:0.26673):0.51352):0.29812,Q9K7Y3_BACHD/10-138:0.91859):0.47248,(O34442_BACSU/8-136:0.59725,Q9KFG8_BACHD/7-135:0.43942):0.34419):0.32138,((O06312_MYCTU/7-136:1.52181,(Q98MM2_RHILO/1-125:0.80455,(Q8FVG5_BRUSU/12-135:0.51376,(Q8PFA5_XANAC/1-125:0.55318,Q8UGN7_AGRT5/7-128:0.62587):0.14706):0.08729):0.44151):0.38951,(Q8NRC7_CORGL/160-288:0.47961,(O86315_MYCTU/159-287:0.54427,Q9FBK4_STRCO/155-283:0.38709):0.14184):0.36754):0.17205):0.05925):0.03447):0.25558,(((Q89JN2_BRAJA/30-158:0.30587,((Q8UF52_AGRT5/32-160:0.22451,Q92QC9_RHIME/31-159:0.10789):0.09293,Q98KU3_RHILO/28-156:0.15787):0.36973):0.51847,Q9A6C0_CAUCR/45-173:0.77907):0.11629,(Q8A0H9_BACTN/3-133:0.50195,Q92H85_RICCN/19-147:1.28504):0.15432):0.24532):0.16221,(((Q8ZCW9_YERPE/50-178:0.73023,(Q885I7_PSESM/39-167:0.37404,Q9JWC7_NEIMA/43-171:0.46625):0.14600):0.33690,(Q8P704_XANCP/11-139:0.43720,(Q8DE98_VIBVU/11-139:0.33363,(Q8EAE0_SHEON/12-140:0.12859,Q9S0K7_SHEVI/12-140:0.17845):0.20358):0.31923):0.13625):0.29546,(O84197_CHLTR/14-143:1.75879,(Q8EGN5_SHEON/17-145:0.72469,(Q87GS5_VIBPA/8-137:0.10856,(Q9KLC8_VIBCH/8-137:0.20696,Q8D5W6_VIBVU/8-137:0.15860):0.03632):0.66317):0.53057):0.28587):0.11970):0.00000,O68316_VIBCH/17-133:3.07160):0.27765):0.06962,((Q8KBD4_CHLTE/4-132:0.80014,(Q8PWC9_METMA/2-127:0.92124,((Q8NTS8_CORGL/8-136:0.51114,Q8FUE7_COREF/31-159:0.65387):0.77766,((P73368_SYNY3/19-147:0.27819,Q8YLW2_ANASP/21-149:0.31491):0.34365,Q8YWD1_ANASP/18-144:0.47348):0.06773):0.03252):0.20648):0.08118,Q9X0P4_THEMA/3-131:0.53304):0.12180):0.27068,(O83887_TREPA/2-130:0.58484,Q8RDN1_FUSNN/4-132:0.43293):0.03128,Q895C8_CLOTE/5-133:0.47935);
RTP  ((((Q8EHS2_SHEON/11-139,Q9PRD6_UREPA/19-147),((((Q8XL02_CLOPE/7-129,((Q8XKS1_CLOPE/162-290,Q97L78_CLOAB/2-130),((((Q8ERS6_OCEIH/15-143,(Q8CPS5_STAEP/15-145,Q99V82_STAAM/15-145)),Q9K7Y3_BACHD/10-138),(O34442_BACSU/8-136,Q9KFG8_BACHD/7-135)),((O06312_MYCTU/7-136,(Q98MM2_RHILO/1-125,(Q8FVG5_BRUSU/12-135,(Q8PFA5_XANAC/1-125,Q8UGN7_AGRT5/7-128)))),(Q8NRC7_CORGL/160-288,(O86315_MYCTU/159-287,Q9FBK4_STRCO/155-283)))))),(((Q89JN2_BRAJA/30-158,((Q8UF52_AGRT5/32-160,Q92QC9_RHIME/31-159),Q98KU3_RHILO/28-156)),Q9A6C0_CAUCR/45-173),(Q8A0H9_BACTN/3-133,Q92H85_RICCN/19-147))),(((Q8ZCW9_YERPE/50-178,(Q885I7_PSESM/39-167,Q9JWC7_NEIMA/43-171)),(Q8P704_XANCP/11-139,(Q8DE98_VIBVU/11-139,(Q8EAE0_SHEON/12-140,Q9S0K7_SHEVI/12-140)))),(O84197_CHLTR/14-143,(Q8EGN5_SHEON/17-145,(Q87GS5_VIBPA/8-137,(Q9KLC8_VIBCH/8-137,Q8D5W6_VIBVU/8-137)))))),O68316_VIBCH/17-133)),((Q8KBD4_CHLTE/4-132,(Q8PWC9_METMA/2-127,((Q8NTS8_CORGL/8-136,Q8FUE7_COREF/31-159),((P73368_SYNY3/19-147,Q8YLW2_ANASP/21-149),Q8YWD1_ANASP/18-144)))),Q9X0P4_THEMA/3-131)),(O83887_TREPA/2-130,Q8RDN1_FUSNN/4-132),Q895C8_CLOTE/5-133);
RTL  42.047
LNK  O06312_MYCTU/7-136:O06312:BX842573
LNK  O34442_BACSU/8-136:O34442:AJ002571
LNK  O50166_BORBU/1-129:O50166:
LNK  O68316_VIBCH/17-133:O68316:AF031552
LNK  O83887_TREPA/2-130:O83887:AE001260
LNK  O84197_CHLTR/14-143:O84197:AE001293
LNK  O86315_MYCTU/159-287:O86315:BX842575
LNK  P73368_SYNY3/19-147:P73368:BA000022
LNK  Q87GS5_VIBPA/8-137:Q87GS5:BA000032
LNK  Q885I7_PSESM/39-167:Q885I7:AE016862
LNK  Q895C8_CLOTE/5-133:Q895C8:AE015940
LNK  Q89JN2_BRAJA/30-158:Q89JN2:BA000040
LNK  Q8A0H9_BACTN/3-133:Q8A0H9:AE016943
LNK  Q8CPS5_STAEP/15-145:Q8CPS5:AE016746
LNK  Q8D5W6_VIBVU/8-137:Q8D5W6:AE016810
LNK  Q8DE98_VIBVU/11-139:Q8DE98:AE016799
LNK  Q8EAE0_SHEON/12-140:Q8EAE0:AE015827
LNK  Q8EGN5_SHEON/17-145:Q8EGN5:AE015602
LNK  Q8EHS2_SHEON/11-139:Q8EHS2:AE015558
LNK  Q8ERS6_OCEIH/15-143:Q8ERS6:BA000028
LNK  Q8FUE7_COREF/31-159:Q8FUE7:BA000035
LNK  Q8FVG5_BRUSU/12-135:Q8FVG5:AE014292
LNK  Q8KBD4_CHLTE/4-132:Q8KBD4:AE012937
LNK  Q8NRC7_CORGL/160-288:Q8NRC7:BA000036
LNK  Q8NTS8_CORGL/8-136:Q8NTS8:BA000036
LNK  Q8P704_XANCP/11-139:Q8P704:AE012393
LNK  Q8PFA5_XANAC/1-125:Q8PFA5:AE012056
LNK  Q8PWC9_METMA/2-127:Q8PWC9:AE013401
LNK  Q8RDN1_FUSNN/4-132:Q8RDN1:AE010654
LNK  Q8UF52_AGRT5/32-160:Q8UF52:AE009113
LNK  Q8UGN7_AGRT5/7-128:Q8UGN7:AE009064
LNK  Q8XKS1_CLOPE/162-290:Q8XKS1:BA000016
LNK  Q8XL02_CLOPE/7-129:Q8XL02:BA000016
LNK  Q8YLW2_ANASP/21-149:Q8YLW2:BA000019
LNK  Q8YWD1_ANASP/18-144:Q8YWD1:BA000019
LNK  Q8ZCW9_YERPE/50-178:Q8ZCW9:AJ414153
LNK  Q92H85_RICCN/19-147:Q92H85:AE008643
LNK  Q92QC9_RHIME/31-159:Q92QC9:AL591787
LNK  Q97L78_CLOAB/2-130:Q97L78:AE007583
LNK  Q98KU3_RHILO/28-156:Q98KU3:BA000012
LNK  Q98MM2_RHILO/1-125:Q98MM2:BA000012
LNK  Q99V82_STAAM/15-145:Q99V82:BA000017
LNK  Q9A6C0_CAUCR/45-173:Q9A6C0:AE005889
LNK  Q9FBK4_STRCO/155-283:Q9FBK4:AL939122
LNK  Q9JWC7_NEIMA/43-171:Q9JWC7:AL162753
LNK  Q9K7Y3_BACHD/10-138:Q9K7Y3:BA000004
LNK  Q9KFG8_BACHD/7-135:Q9KFG8:BA000004
LNK  Q9KLC8_VIBCH/8-137:Q9KLC8:AE004410
LNK  Q9PRD6_UREPA/19-147:Q9PRD6:AE002100
LNK  Q9S0K7_SHEVI/12-140:Q9S0K7:AB033988
LNK  Q9X0P4_THEMA/3-131:Q9X0P4:AE001773
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx......xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9X0P4_THEMA/3-131
ASQ  IKVEIDLQELIEKGDFKTLKRVLEQQDPA.DVKEMIEKLPPDLKVVVFRLLP.KDKAAEVFSELEPDDQLE..LIKLFREERLKEIFE.SMDPDDRVELLEEMPANVVKKLLSYL.PPQEREELLYILNYPEDSA
DSQ  ATCAAGGTAGAGATCGATCTTCAGGAATTGATCGAAAAAGGAGACTTCAAGACGCTCAAAAGGGTTCTCGAACAGCAGGATCCCGCC...GATGTGAAAGAGATGATCGAAAAGCTCCCGCCCGACCTGAAAGTGGTTGTTTTCAGGCTCCTTCCC...AAAGATAAAGCTGCTGAAGTGTTCAGTGAACTCGAACCCGACGATCAGCTGGAA......CTCATAAAGCTTTTCAGAGAGGAACGCCTGAAAGAGATCTTCGAA...TCGATGGATCCGGACGACAGAGTGGAACTACTCGAAGAGATGCCCGCAAACGTGGTGAAAAAACTCCTTTCGTACCTT...CCTCCACAGGAAAGGGAGGAACTTCTTTACATCCTGAATTATCCTGAAGATTCTGCG
TRN  10010101100011011
NAM  Q8YWD1_ANASP/18-144
ASQ  TQDVR--IALMDVADLNQLKWDLNRLQPV.DVGEYITQLPEKQRAIAFRLLN.KNQAIDVFEYLPTEVQEE..LINSLHDAQVVQLVE.EMSPDERAELFDELPAGVIKRLLREL.SPEQRQATATILGYPEGTA
DSQ  ACACAGGATGTTCGC------ATTGCGCTCATGGATGTTGCTGATTTAAACCAGCTCAAGTGGGATTTAAATCGGCTGCAACCTGTA...GATGTAGGCGAGTATATTACTCAATTGCCAGAAAAGCAGCGAGCGATCGCCTTTCGTCTCCTCAAC...AAAAATCAGGCAATTGATGTATTTGAATATTTGCCGACAGAAGTTCAAGAAGAA......CTAATTAACTCCCTGCATGATGCACAGGTGGTGCAACTTGTGGAG...GAAATGAGTCCCGATGAACGGGCAGAATTATTTGATGAACTACCTGCTGGTGTCATCAAGCGGTTATTACGAGAACTC...AGTCCCGAACAAAGACAAGCAACCGCTACTATTCTCGGTTATCCCGAAGGTACAGCC
TRN  10010101100011010
NAM  Q8YLW2_ANASP/21-149
ASQ  DLVRTQMRMLLEAGDLQGAKAILVPVQPA.DIAEAIEGLPETMHALAFRLLS.KDEAIEVYEYLDYSVQER..LIEELKSQEVRDIVD.QMSSDDRARLFDELPAKVVNHLLEQL.SPTERQATALMLGYEADTA
DSQ  GACTTAGTGCGGACACAGATGCGAATGCTATTGGAAGCAGGAGATTTACAGGGAGCAAAAGCCATTCTTGTACCTGTACAGCCTGCG...GACATAGCCGAAGCGATTGAAGGTTTGCCCGAAACAATGCACGCTTTAGCTTTTCGCTTGCTTTCT...AAAGATGAAGCCATTGAAGTTTATGAATATCTTGATTACAGTGTTCAAGAAAGA......TTAATTGAAGAACTGAAAAGCCAGGAAGTCCGCGATATCGTTGAT...CAAATGTCTTCGGATGACCGAGCTAGATTATTTGATGAATTGCCTGCCAAAGTTGTCAATCACCTGCTAGAACAACTC...AGCCCGACAGAACGCCAAGCCACAGCCCTAATGTTGGGTTATGAAGCTGATACAGCC
TRN  10010101100011010
NAM  P73368_SYNY3/19-147
ASQ  KLVRAQIETLLETSQFDAAKTILTPVQPA.DIADVIESLPSRLQVLAFRLLS.KNEAIDVYEHLAPPVQES..LLEDFKHPEVLEIFN.QMSPDDRVRLLDELPAKVVRQLFKHL.SNEERKATSLLLGYKPETA
DSQ  AAATTAGTGCGGGCCCAGATTGAAACTCTGCTAGAAACCTCCCAATTCGATGCCGCTAAAACCATTCTCACCCCTGTGCAACCGGCG...GATATTGCTGATGTGATCGAGTCTCTGCCCAGTCGTTTACAGGTGCTAGCCTTTCGTTTACTTTCC...AAAAATGAGGCGATCGATGTTTATGAGCATTTAGCTCCACCAGTGCAGGAATCC......CTGCTAGAAGATTTTAAGCATCCTGAAGTACTGGAAATTTTTAAC...CAAATGTCCCCCGATGACCGGGTCAGGCTATTGGACGAACTTCCGGCCAAGGTGGTGCGGCAACTATTCAAACACCTC...AGCAACGAAGAACGCAAAGCTACTTCCCTACTGTTGGGCTATAAACCGGAAACCGCT
TRN  10010101100011010
NAM  Q8KBD4_CHLTE/4-132
ASQ  TPILPEIRELIEQRNFSALQRLFDDWLPV.DLAELISDLPENEQAILFRLLP.KDVATETFEYLDFDAQQN..LLNALTQKDVTHILN.SMSADDRTALLEELPGPVAQELIKLL.SFKEFKIAKTLLAYAEDSV
DSQ  ACTCCTATCCTTCCAGAAATTCGTGAGCTGATCGAACAGAGAAACTTCAGCGCCCTGCAACGCCTCTTCGACGACTGGCTCCCGGTT...GACCTGGCCGAACTGATTTCCGATCTGCCTGAAAACGAGCAGGCAATTCTCTTCCGGCTGCTTCCC...AAAGACGTGGCTACCGAAACCTTCGAGTACCTCGACTTCGATGCCCAGCAAAAC......CTGCTCAACGCCCTGACGCAAAAGGATGTCACCCACATCCTCAAC...AGCATGTCGGCTGACGACCGCACGGCGCTGCTCGAAGAGCTGCCCGGCCCGGTGGCGCAGGAGCTGATCAAGCTGCTT...TCATTCAAAGAGTTCAAGATCGCCAAGACGCTGCTCGCCTACGCCGAGGATAGCGTC
TRN  10010101100011001
NAM  Q8PWC9_METMA/2-127
ASQ  HSEFK---ELLDKRDWEGLRVLIREMKPS.EIEDLYFELDGRDFVILFRLLE.KDLALEIFESFSVEHQVE..IIKLMEEADTIDLLE.PLDPDDCARIFEELPAKITKRLLNGL.SPERRKYVNLLLGYPEGSA
DSQ  CATTCTGAATTCAAA---------GAGCTGCTGGATAAAAGGGACTGGGAAGGCTTAAGGGTTTTAATCAGGGAGATGAAACCTTCC...GAGATTGAGGATCTGTATTTTGAGTTAGATGGCAGAGATTTTGTGATACTTTTCCGGCTTCTTGAG...AAAGATCTGGCACTTGAAATCTTTGAAAGCTTTAGTGTGGAACATCAGGTTGAG......ATAATAAAATTAATGGAAGAAGCGGATACAATAGATCTGCTTGAG...CCCCTTGACCCTGATGACTGTGCAAGGATATTTGAAGAACTGCCTGCAAAGATAACAAAACGCCTGCTTAACGGGCTG...AGCCCTGAGAGGCGCAAATATGTGAACCTGCTCCTTGGTTATCCTGAAGGAAGTGCA
TRN  10010101100011010
NAM  Q895C8_CLOTE/5-133
ASQ  KKEFEEIISLIHEKKFHNAREKILELNPV.HISDIIECLDISEAILVFRMLP.KDMAVDVFNYLEKDFQTN..IITGITDKEIKHIIE.EIYFDDMIDLLEEMPANVVKKILKYS.NVEERKLINEFLNYPEDSA
DSQ  AAAAAAGAATTTGAAGAAATCATATCTCTTATTCATGAAAAAAAGTTTCATAATGCAAGAGAGAAGATTTTAGAACTAAATCCTGTG...CATATATCAGATATTATTGAATGTCTTGATATATCAGAAGCAATTTTGGTTTTTAGAATGCTTCCA...AAGGATATGGCAGTAGATGTATTTAATTACTTAGAAAAGGATTTTCAAACAAAT......ATTATAACTGGTATTACTGATAAAGAAATAAAACACATTATAGAA...GAAATTTATTTTGACGATATGATCGACCTTTTGGAAGAAATGCCAGCAAATGTAGTAAAAAAAATCTTAAAGTATTCA...AATGTAGAAGAGAGAAAACTTATAAATGAATTTCTAAATTATCCAGAGGATTCTGCA
TRN  10010101110011000
NAM  Q8RDN1_FUSNN/4-132
ASQ  GIKLEEIIQLLEQNRLAELKEILIKENPI.DVADVFEEFPKEKDLIIFKLLP.KDFSSEVFSYLSPEKQQE..VIENITDEEIKFIME.DMYLDDTVDFIEEMPANIVDKILKNT.SHDKRKLINQMLKYPENSA
DSQ  GGGATAAAGTTGGAAGAAATAATTCAATTATTAGAACAAAACAGATTAGCCGAACTAAAAGAAATTTTAATTAAGGAAAATCCAATA...GATGTTGCAGATGTTTTTGAGGAATTTCCCAAAGAGAAAGACTTAATTATATTTAAGTTATTGCCA...AAGGATTTTTCATCAGAAGTTTTTTCTTATTTATCTCCTGAAAAACAACAAGAA......GTTATTGAAAATATAACAGATGAAGAGATAAAGTTTATTATGGAA...GATATGTATCTTGATGATACAGTGGATTTCATAGAAGAGATGCCAGCAAATATTGTGGACAAGATATTAAAAAATACA...TCTCATGATAAAAGAAAATTGATAAATCAGATGTTGAAATATCCAGAAAATTCAGCT
TRN  10010101110011000
NAM  O83887_TREPA/2-130
ASQ  NENFEKIQTLLEHKRYVPLIANLNEMNEV.DVAHVLDMQSPAQALLLFRMLP.KNLAANVFAQLSSSKQSA..FLATITDRELAPILA.ELAMDDIVDLVEEMPANAVKRILAQT.GETERQVINQLLKYPEDSA
DSQ  AACGAGAACTTTGAAAAAATCCAGACGCTTCTCGAGCACAAGCGTTACGTACCACTTATTGCAAATCTAAACGAGATGAACGAGGTG...GACGTCGCGCATGTCTTGGACATGCAATCACCTGCACAGGCGTTGTTGCTATTTAGAATGCTGCCC...AAGAACCTCGCTGCAAATGTGTTTGCGCAGCTTTCAAGCAGCAAACAATCTGCT......TTTCTCGCCACCATTACAGACAGAGAGCTTGCACCTATTCTTGCA...GAACTCGCCATGGATGATATAGTCGATTTGGTAGAAGAAATGCCTGCAAATGCTGTGAAACGCATTCTCGCACAAACG...GGTGAAACAGAACGTCAAGTTATCAATCAACTTTTAAAATATCCAGAGGATTCTGCA
TRN  10010101100011000
NAM  O50166_BORBU/1-129
ASQ  MIDIDELRIFLKEKSYSKIKEKFLKXDSX.DIAEALKRLNGTELILLYRFLP.KKIAVETFSNFDQSTKNK..LANSFTNKEISEMID.ELNLDDVIDLLEEVPANVVQRFLASS.TEENREIINKFLSYSDDSA
NAM  Q8FUE7_COREF/31-159
ASQ  LEQILREDSEVAPGGARKISELLGSIGLK.DLIHVLERMPSVRAALILRLLP.RRRSIEAFEALDAAHQAD..LVDALGDDSLVSFFD.ALDPDDRVSLLDELPAEIAERLMRSL.EESQHDLTSVILGYPKGSI
DSQ  CTCGAGCAGATTCTGCGGGAGGACAGTGAAGTAGCCCCGGGTGGTGCCCGGAAGATCTCGGAGTTGTTGGGCTCCATCGGGTTGAAG...GATCTCATCCACGTGTTGGAGAGGATGCCGTCGGTACGCGCGGCCCTGATCCTGCGCCTGTTGCCG...CGTCGGCGCTCCATCGAGGCCTTCGAGGCGCTGGATGCCGCGCATCAGGCGGAT......CTGGTGGATGCGCTTGGCGACGATTCCCTCGTCTCCTTCTTCGAC...GCCCTCGACCCCGACGACCGTGTGTCCCTGCTCGATGAGCTGCCGGCGGAGATCGCGGAACGTCTCATGCGCAGCCTG...GAGGAGTCCCAGCATGATCTGACCAGTGTGATCCTGGGGTATCCCAAGGGCTCCATA
TRN  10010101100011011
NAM  Q8NTS8_CORGL/8-136
ASQ  LRGEVCDMKELELGEARDVAATLEAMPIQ.EVIDQVERTSITKGAVLLRLLS.KDRSLLVFDALGPRLQAD..LIGAFQDAEVLDYFA.DLDPDDRVSLLDELPASIADELLRSL.DPQEKQVTELVLGYAKGSV
DSQ  TTGAGGGGAGAGGTGTGTGACATGAAAGAGTTGGAACTGGGCGAGGCGAGGGACGTCGCTGCAACGTTGGAAGCGATGCCGATCCAG...GAGGTTATTGATCAGGTTGAGCGAACTTCTATAACTAAAGGTGCGGTACTGCTGCGTCTGCTCAGT...AAAGATCGATCGTTGTTGGTCTTCGATGCTCTTGGTCCGCGACTCCAGGCTGAT......CTCATTGGTGCTTTTCAGGATGCGGAAGTGCTGGATTATTTCGCT...GACCTTGACCCTGATGACCGCGTTTCACTGCTTGATGAGCTGCCGGCGTCGATCGCTGACGAGTTGCTTCGCAGTCTC...GATCCGCAGGAAAAGCAGGTCACGGAGCTGGTCTTGGGTTACGCAAAGGGGTCGGTT
TRN  10010101100011001
NAM  Q9S0K7_SHEVI/12-140
ASQ  DQRLNRLTQALGSGMFVHVRNMLHDMAAS.DVAFILESSPPRTRQVLWQLID.LDHTGEILDELGEELKDN..LIKQMTPERVAKAAA.GMDTDDLAYILRSLPDSVFNKVLQSM.SSQDRTRVEQALSYPDDTA
DSQ  GATCAACGTCTAAATCGGCTCACCCAAGCCCTTGGTAGTGGTATGTTCGTCCATGTCAGAAACATGCTCCATGATATGGCGGCATCT...GATGTTGCTTTTATTTTAGAATCCTCCCCTCCAAGAACGCGTCAGGTGTTGTGGCAACTTATCGAT...CTGGATCATACCGGCGAGATCTTAGATGAATTAGGTGAGGAGCTAAAAGATAAC......CTCATCAAGCAGATGACACCCGAACGAGTGGCCAAAGCCGCTGCA...GGAATGGATACCGACGATCTCGCTTATATTCTGCGTAGCTTACCGGACAGTGTCTTCAATAAAGTACTCCAGTCCATG...AGCAGTCAAGATAGAACCAGAGTCGAGCAGGCTCTATCCTACCCTGACGACACGGCT
TRN  10010101100011010
NAM  Q8EAE0_SHEON/12-140
ASQ  EHRLDQLSQALNSGMFVHVRQMLQNMASS.DIALILESSPPKARQVLWQLID.QDQLGDILDELSEELKDP..LIRAMSPERVAKATA.SMDTDDLAYILRSLPDTVYKQVLQSM.SLQNRQRVEQALSYPDETA
DSQ  GAACATCGTCTTGACCAACTGAGCCAAGCTCTCAACAGTGGTATGTTTGTGCATGTCAGGCAAATGCTGCAAAACATGGCGTCATCG...GATATTGCATTGATTTTAGAATCTTCACCGCCCAAGGCACGACAAGTACTATGGCAGCTAATCGAT...CAAGATCAGCTCGGGGATATTCTCGATGAACTCAGCGAAGAGTTAAAAGATCCG......CTGATCCGCGCCATGAGCCCTGAACGTGTCGCTAAAGCCACCGCC...AGCATGGATACGGACGATCTGGCTTATATTCTGCGAAGCCTACCTGATACGGTTTACAAACAAGTATTGCAGTCTATG...AGCCTGCAAAACCGTCAGCGGGTCGAGCAAGCGCTCTCCTACCCCGATGAAACCGCG
TRN  10010101100011000
NAM  Q8DE98_VIBVU/11-139
ASQ  HQALQEVSEALENGRFVHVRRQLQDMEPE.DIAHLLEASPRKSREVLWQLTD.PEDYGEILDELSEDVKDS..LVSKMAPEDLAEATE.GMDTDDVAYVLRSLPDNVSREVLAQM.DAADRLRVETALSYSEDTA
DSQ  CACCAAGCCCTCCAGGAAGTTTCTGAAGCGCTCGAAAATGGCCGCTTCGTTCACGTCCGCCGTCAGCTTCAGGACATGGAGCCTGAA...GATATTGCCCATCTACTTGAAGCATCCCCGCGTAAAAGCCGCGAAGTCTTATGGCAACTTACCGAC...CCTGAGGATTATGGTGAAATCCTTGACGAGCTGAGTGAAGACGTCAAAGACAGC......CTTGTCTCAAAAATGGCCCCCGAGGATCTCGCCGAAGCGACCGAA...GGGATGGATACCGATGACGTTGCTTACGTTCTACGTAGCCTACCAGATAACGTTTCTCGTGAAGTACTGGCGCAAATG...GACGCGGCGGATCGTCTGCGCGTGGAAACCGCGCTGTCCTATTCTGAGGACACGGCC
TRN  11011101101011000
NAM  Q9JWC7_NEIMA/43-171
ASQ  IENGTPLEDAPLRDKLTELTVLLSELHPA.DVAAVLESLPPRERNIVWILVK.PEDDGEVLLEVSDAVRET..LIESMDKDELLAAVD.DLDADELAELADDLPHQVVYEALQTR.DEEERAQVKAAMSYEDNQV
DSQ  ATCGAAAACGGTACACCGCTCGAAGACGCGCCGCTGCGCGACAAGCTGACCGAGCTGACCGTCCTCTTGAGCGAGCTGCACCCTGCC...GACGTGGCGGCGGTGTTGGAATCGCTGCCGCCGCGCGAACGCAATATCGTCTGGATTTTAGTGAAA...CCCGAAGACGACGGCGAAGTATTGCTGGAAGTATCCGACGCGGTGCGCGAAACG......CTGATCGAGTCGATGGACAAAGACGAATTGTTGGCGGCGGTCGAT...GATTTGGACGCGGACGAATTGGCGGAGCTGGCAGACGATTTGCCGCACCAAGTGGTTTATGAAGCCTTACAGACGCGC...GATGAGGAAGAACGCGCCCAAGTCAAGGCGGCAATGTCCTACGAAGACAACCAAGTC
TRN  11011101101011010
NAM  Q885I7_PSESM/39-167
ASQ  GQNQDRVENLVHRQNLVELQRKLEDLHSA.DVAYILEALPLEDRLTVWQLVK.ADRDGDILLEVSDSVRET..LIADMDDHELLAAAR.DMDADELADLAPELPRDVVHELMEAL.DSQQRERVRSALSYDEDQV
DSQ  GGTCAGAATCAAGACCGCGTAGAAAACCTGGTTCACCGGCAGAACCTTGTCGAGCTGCAGCGCAAGCTCGAAGACCTTCACTCCGCC...GACGTCGCTTATATTCTCGAAGCCCTTCCTCTGGAAGATCGCCTGACCGTCTGGCAGCTGGTCAAG...GCCGATCGCGACGGCGACATTCTGCTTGAAGTATCCGATTCCGTTCGTGAAACC......CTGATCGCCGACATGGACGATCATGAGTTGCTCGCGGCGGCACGG...GACATGGACGCCGACGAACTGGCCGACCTTGCTCCCGAATTGCCCCGCGACGTTGTTCATGAACTGATGGAAGCGCTG...GACTCTCAGCAGCGCGAGCGTGTCCGGTCTGCCTTGTCCTATGACGAGGACCAGGTT
TRN  11011111101111111
NAM  Q8P704_XANCP/11-139
ASQ  ARQLRLLSDALDSGRLGPVRRLVNTLAPA.EIGNLLESLPPGKREVVWGLVD.PEDDGEVLLHVGDEVRES..LLADMDPDEIVAAVE.DLDIDDLANLVEDLPDTVIDEVLKSM.DRENRERLEQVLSYPEDTA
DSQ  GCGCGCCAGCTACGCCTGCTGTCCGACGCGCTGGACAGCGGGCGTCTCGGGCCGGTGCGTCGGTTGGTCAACACGTTGGCGCCGGCG...GAGATCGGCAACCTGCTGGAATCACTGCCGCCGGGCAAGCGCGAGGTGGTGTGGGGGCTGGTCGAC...CCGGAAGACGATGGCGAGGTGCTGCTGCACGTCGGCGATGAAGTACGCGAAAGC......CTGCTCGCCGACATGGACCCGGACGAAATCGTCGCCGCGGTCGAA...GATCTGGACATCGACGACCTGGCCAACCTGGTCGAGGACCTGCCCGATACCGTCATCGACGAAGTGCTCAAGTCGATG...GACCGCGAGAACCGCGAGCGGTTGGAACAGGTGCTTTCGTATCCGGAAGACACCGCC
TRN  11011111101111101
NAM  Q8ZCW9_YERPE/50-178
ASQ  QEERENLSDEQLQDQTAEIKTLLDDLHAA.DLADLLEALPNDERLALWRLVK.NEKRGQTLVEVSETVWDT..LIKEMSDKDLLKAMR.TLHVDEQAYLAEYLPRNLMGRLLTSL.DPDQRARVREVIQYGRDSV
DSQ  CAGGAGGAGCGGGAAAATCTCAGTGATGAACAACTGCAGGATCAAACCGCAGAAATAAAAACCTTGCTCGATGACCTGCATGCAGCA...GATCTCGCCGACTTACTGGAAGCATTACCCAACGACGAACGTTTGGCACTCTGGCGGTTGGTTAAA...AATGAGAAGCGCGGCCAAACACTGGTTGAAGTCTCTGAGACCGTGTGGGATACC......CTGATCAAAGAGATGAGCGATAAAGACCTGTTAAAAGCCATGCGC...ACCTTGCATGTGGATGAACAGGCTTATCTGGCCGAGTATTTACCGCGTAACCTGATGGGCCGCTTACTGACGTCATTA...GATCCAGATCAACGGGCCCGAGTTCGTGAAGTGATTCAGTATGGCCGCGACAGTGTC
TRN  10010101100011000
NAM  Q9A6C0_CAUCR/45-173
ASQ  PEYVEMVIDAADRGDAKRLRELVGALDPA.DVADLMGFLTADYREEVIPLLD.PEALGEIISELEDNIREE..VLEATPSVTLARALE.ELDTDDAADVIDDLDDTKRFQVLAAM.GETDRAAIETTLSYEDETA
DSQ  CCCGAATATGTCGAGATGGTGATCGACGCCGCCGACCGCGGCGACGCCAAGCGCCTGCGCGAGCTGGTGGGGGCCCTGGACCCCGCC...GACGTCGCCGACCTGATGGGCTTTCTGACGGCCGACTATCGCGAGGAAGTGATCCCGCTGCTCGAC...CCCGAGGCGCTGGGCGAGATCATTTCCGAGCTGGAGGACAACATCCGCGAGGAA......GTGCTGGAGGCCACCCCGTCGGTGACCCTGGCCCGGGCCCTCGAG...GAGCTGGACACCGACGACGCCGCCGACGTTATCGACGACCTGGACGACACCAAGCGCTTCCAGGTGCTGGCCGCCATG...GGCGAGACCGACCGCGCCGCCATCGAGACGACCCTGTCCTACGAGGACGAGACCGCC
TRN  11011111101111111
NAM  Q8A0H9_BACTN/3-133
ASQ  EEYIDNVKHLIEQKDADKVKELLVDLHPA.DIAELCDDLNPEEARFVYRLLN.NETAADVLVEMDEDVRKE..FLEMIPSETIAKRFVdYMDTDDAVDLMRDLDEDKQEEILSHIeDIEQAGDIVDLLKYDENTA
DSQ  GAGGAATACATTGACAACGTAAAACACCTTATCGAGCAAAAAGATGCCGATAAGGTTAAAGAACTTCTTGTCGACCTTCATCCCGCC...GACATCGCTGAATTGTGTGATGACCTGAACCCGGAAGAAGCCCGGTTTGTCTACCGCCTGCTCAAC...AATGAAACCGCGGCCGACGTACTCGTCGAAATGGATGAGGACGTTCGTAAAGAG......TTCCTCGAAATGATCCCTTCGGAAACAATCGCCAAGCGCTTTGTGgacTACATGGACACGGATGATGCCGTAGACCTGATGCGTGACCTCGACGAAGACAAGCAGGAAGAAATTCTTTCGCACATCgaaGACATCGAACAGGCAGGAGACATCGTGGACCTCTTGAAATATGACGAAAACACCGCC
TRN  11011101101011011
NAM  Q98KU3_RHILO/28-156
ASQ  SSFLAQIGAAIADRDTLTLKHEVDHLHQS.ELGDLIEALHPEQRRALVELLG.ADFDFSALTEVDEAIRME..IVDHLPNAQIAQAVQ.ELDSDDAVYILEDLEKEDQDEILSQL.PFTERIRLRRSLDYPEETA
DSQ  TCGTCCTTCCTTGCCCAGATCGGCGCCGCGATCGCCGACCGCGATACTCTGACCCTCAAGCATGAAGTCGACCACCTGCACCAGTCG...GAACTGGGCGACCTGATCGAGGCGTTGCATCCCGAACAGCGGCGAGCCCTGGTCGAACTGCTGGGC...GCCGATTTCGACTTCTCCGCGCTGACCGAGGTCGATGAGGCGATCCGCATGGAG......ATCGTCGATCATCTGCCCAATGCGCAGATCGCGCAGGCGGTGCAG...GAACTCGATTCCGACGACGCCGTCTACATTCTCGAAGACCTCGAAAAGGAAGACCAGGACGAGATCCTGTCGCAGCTG...CCGTTCACCGAACGGATCAGGCTGCGCCGCTCGCTCGATTACCCGGAAGAGACCGCC
TRN  10010101100011011
NAM  Q92QC9_RHIME/31-159
ASQ  SDFLMHVGAAIADRDTIYLRQHVAGLHAS.ELGDLIEAIQPEQRIALVLLLG.KDFDLAALTEVDEGIRLD..IVEHLPNEQIAEAIG.EMDSDDAVYILEDLDEEDQEEILAKL.PFTERVRLRRSLDYPESTA
DSQ  TCCGATTTCCTGATGCATGTCGGCGCCGCGATCGCGGATCGCGATACCATCTATCTTCGCCAGCATGTCGCCGGCCTCCATGCCTCG...GAACTCGGTGACCTTATCGAGGCGATCCAGCCGGAGCAGCGTATCGCTCTGGTTCTGCTGCTCGGC...AAGGACTTCGACCTGGCTGCGCTGACCGAGGTCGATGAAGGAATCCGTCTCGAC......ATCGTCGAACATCTGCCGAACGAGCAGATTGCCGAGGCGATCGGC...GAGATGGATTCCGATGACGCGGTCTACATTCTCGAGGATCTCGACGAGGAGGATCAGGAAGAGATCCTCGCCAAGCTT...CCCTTTACCGAGCGCGTCCGCCTACGCCGCTCGCTCGACTATCCGGAGAGCACCGCC
TRN  11011111101111111
NAM  Q8UF52_AGRT5/32-160
ASQ  SDFLAMVGAAIADRDLLFLRKNVARLHES.ELGDVLESILPEQRHALVRLLG.SDFDMTALTEVDEGIRLD..IVDQMSNEQIAAGIG.ELDSDDAVYILEDLDDEDREDILSQL.PFTERVRLMRALDYPESSA
DSQ  TCCGATTTTCTGGCGATGGTTGGCGCTGCGATCGCCGATCGCGACCTGCTTTTCCTGCGTAAGAATGTTGCGCGGCTGCATGAGTCA...GAGCTCGGCGACGTGCTCGAATCCATCCTGCCGGAACAGCGCCACGCGCTGGTTAGGCTTCTGGGT...TCCGATTTCGACATGACGGCGCTGACCGAGGTGGATGAGGGCATCCGTCTCGAT......ATCGTCGACCAGATGTCGAACGAGCAGATCGCCGCCGGTATCGGC...GAACTCGATTCGGACGACGCGGTCTACATTCTCGAGGACCTCGACGACGAGGACCGCGAGGATATTCTCTCGCAACTG...CCGTTTACCGAACGCGTGCGGCTGATGCGGGCGCTGGATTATCCGGAAAGCTCGGCC
TRN  10010101100011001
NAM  Q89JN2_BRAJA/30-158
ASQ  HEFVEEIARAIEAGDSAALRACVAELHEA.DLGDLIGALEPDDRVRLVELTG.RDFDFSALNEVDESVREE..ILDELPPETVAEGVR.ELESDDAVELLETLDEAEQEEILEKL.PMRERVALERSLLYPENSA
DSQ  CATGAATTCGTCGAGGAAATTGCCCGTGCGATCGAGGCCGGAGACAGTGCCGCGCTGCGCGCCTGCGTCGCCGAGCTGCACGAGGCC...GATCTCGGCGATCTCATCGGCGCGCTCGAGCCCGACGATCGCGTCCGCCTGGTTGAGCTCACGGGC...CGCGACTTCGACTTTTCGGCGCTGAACGAGGTCGACGAGAGCGTCCGCGAGGAG......ATCCTCGATGAGTTGCCGCCGGAGACGGTCGCGGAAGGCGTCCGC...GAGCTCGAATCCGACGACGCGGTCGAGCTGCTGGAGACCCTCGACGAGGCCGAGCAGGAGGAGATCCTCGAGAAGCTG...CCCATGCGGGAGCGCGTCGCGCTCGAGCGCAGCCTGCTGTATCCGGAAAATTCCGCC
TRN  11011111101111111
NAM  Q9KFG8_BACHD/7-135
ASQ  DQLLVLMIKYLKDSKRGALQQMLDELHPY.DVAQLYRSLPDKHHHKFLTFLT.PDQIADLIQELDSDMQIE..ILHRLGIERSSKVMN.LMDNDDLADLLNELSVERIQEFLDAM.KDDESEKVQSLMGYDPETA
DSQ  GATCAGCTTCTCGTTCTCATGATTAAATATCTTAAGGATTCTAAACGCGGTGCCCTGCAGCAAATGCTTGATGAGTTGCATCCTTAC...GACGTTGCACAGCTTTATCGCAGTTTACCGGATAAGCATCATCACAAGTTTTTAACCTTTTTAACA...CCTGATCAAATTGCCGATTTAATTCAAGAGCTTGATTCAGATATGCAAATCGAG......ATTTTGCACAGACTCGGGATTGAACGATCATCAAAGGTTATGAAC...CTTATGGACAACGATGACCTTGCTGACTTGTTGAATGAACTATCCGTTGAACGTATTCAAGAATTTCTCGATGCGATG...AAAGACGATGAATCGGAAAAAGTTCAGTCACTTATGGGGTATGATCCAGAAACAGCT
TRN  10010101100011000
NAM  O34442_BACSU/8-136
ASQ  DELILRIIILLRDGKIRDFRSVIDELQPY.DMAFIFKEMPEKHRARYLSYLT.VDDITDMIGELEREFQLV..VLNKVGKTKATLAMN.KMDNDDLAQLLEEMDEELKEQLLSSM.EASESKAVQLLMNYPADSA
DSQ  GACGAACTCATTTTACGCATCATTATTTTACTGCGAGACGGGAAAATCAGGGATTTTAGAAGTGTTATTGATGAGCTTCAGCCCTAT...GACATGGCATTTATTTTTAAAGAAATGCCGGAAAAACATCGCGCCCGCTATTTATCTTATTTAACT...GTAGACGATATCACTGATATGATCGGGGAGCTGGAACGCGAATTTCAGCTTGTC......GTCTTAAATAAAGTCGGAAAAACAAAAGCAACACTGGCGATGAAC...AAAATGGACAACGATGACCTCGCTCAATTGCTTGAAGAAATGGACGAAGAACTGAAGGAACAGCTTTTATCCAGCATG...GAAGCGTCAGAATCAAAAGCTGTACAGCTCTTGATGAATTACCCGGCTGATTCAGCG
TRN  10010101100011000
NAM  Q9FBK4_STRCO/155-283
ASQ  WSGVSGFSVEEQGQGAENLLATFEQLRPA.DLANVLHHLSAKRRAEVAAALD.DDRLADVLEELPEDDQIE..ILGKLKEERAADVLE.AMDPDDAADLLGELPEADKERLLSLM.QPEDAADMRRLMAYEEHTA
DSQ  TGGTCCGGCGTCTCCGGCTTCTCCGTCGAGGAGCAGGGGCAGGGCGCCGAGAACCTGCTGGCCACCTTCGAGCAGCTGCGCCCCGCC...GACCTCGCCAACGTCCTGCACCACCTGTCCGCCAAGCGCCGCGCCGAGGTCGCCGCCGCCCTCGAC...GACGACCGGCTGGCCGACGTGCTGGAGGAGCTGCCGGAGGACGACCAGATCGAG......ATCCTCGGCAAGCTCAAGGAGGAGCGCGCCGCGGACGTCCTGGAG...GCGATGGACCCCGACGACGCGGCCGACCTGCTCGGGGAGCTGCCCGAGGCGGACAAGGAGCGGCTGCTGAGTCTGATG...CAGCCCGAGGACGCGGCCGACATGCGGCGCCTGATGGCGTACGAGGAGCACACGGCC
TRN  11011111101111111
NAM  O86315_MYCTU/159-287
ASQ  VAGLTPSALAMPGQDVAQLLDQFEGWKAV.DVADAIRGLPPKRRHEVFKALH.DKRLADVLQELPELDQAE..VLSQLGTERAADVLE.EMDPDDAADLLAVLNPTEAELLLTRM.DPGDSGQVRRLLTHSPDTA
DSQ  GTGGCGGGGTTGACGCCGTCGGCCTTGGCGATGCCGGGTCAAGACGTGGCACAGCTGCTCGACCAGTTCGAGGGATGGAAAGCGGTC...GACGTGGCCGACGCCATCCGCGGGCTGCCGCCGAAGCGCCGCCACGAGGTGTTCAAGGCGCTCCAC...GACAAGCGCTTGGCCGACGTCCTGCAGGAGCTGCCCGAACTGGATCAGGCCGAG......GTGTTGTCGCAACTGGGCACCGAACGCGCGGCCGACGTGCTGGAG...GAGATGGATCCCGACGACGCCGCCGATCTGCTCGCGGTCCTGAATCCGACCGAAGCCGAGTTGCTGCTGACACGAATG...GATCCCGGCGACTCCGGGCAGGTGCGAAGGCTGCTGACGCACTCCCCCGACACGGCG
TRN  10010101100011011
NAM  Q8NRC7_CORGL/160-288
ASQ  HIHGITAGGVGESNHTAELIAGFEDMRPA.DVAKQLYQLPTAQRTEVTEELD.DEKLADILQELSEDRQAE..LIEELDIERAADILE.EMDPDDAADLLGELPDDKADVLLDLM.DPEESAPVRRLMDFSPDTV
DSQ  CATATCCACGGCATCACCGCAGGTGGTGTCGGCGAGTCCAATCACACCGCCGAACTCATCGCAGGGTTTGAGGATATGAGGCCTGCG...GACGTCGCAAAGCAGCTTTATCAGCTGCCTACGGCTCAGCGTACCGAAGTGACGGAAGAGCTTGAC...GACGAAAAGCTGGCGGATATCCTGCAGGAATTGTCCGAGGACCGCCAAGCCGAG......TTGATTGAAGAATTAGACATCGAACGTGCCGCGGACATTCTGGAG...GAAATGGATCCAGATGATGCTGCAGACTTGTTGGGTGAGCTGCCTGATGACAAAGCTGATGTGTTGTTGGATCTGATG...GACCCTGAGGAATCTGCGCCGGTGCGTCGTTTGATGGATTTCTCCCCGGACACCGTT
TRN  10010101100011010
NAM  Q97L78_CLOAB/2-130
ASQ  WNDVESLEMVNDNLKLTVPYQKLSTMHPA.DLADIIEDMDFNYRKKVFESLD.ENLAADILEEIDPDIQAD..ILESLSDDKKSEVLD.SMPIDEIADILDEVDEETAEKILLNM.EKEDAEEVRALMGYGEETV
DSQ  TGGAACGATGTAGAGTCTTTAGAAATGGTTAATGATAATTTAAAGTTGACAGTGCCTTATCAAAAGCTTTCAACTATGCATCCGGCT...GATTTAGCCGATATAATTGAAGATATGGATTTTAATTATAGAAAAAAGGTTTTTGAAAGTCTTGAT...GAAAATTTAGCTGCTGACATACTAGAGGAGATAGACCCAGATATTCAAGCGGAT......ATACTTGAAAGCCTAAGTGATGATAAGAAAAGTGAAGTACTAGAT...AGTATGCCTATTGATGAAATTGCAGATATCTTGGATGAAGTTGATGAAGAAACTGCTGAAAAGATATTGCTTAATATG...GAAAAGGAAGATGCAGAAGAAGTTAGAGCACTCATGGGGTATGGAGAAGAAACCGTG
TRN  10010101110011000
NAM  Q8XKS1_CLOPE/162-290
ASQ  WEDVESLEMINDNLKLAIPYKKLQKLHPA.DLADILEELDAINRKKVFDSLD.EDLAADTLEEIEPEVQSS..IIKGLSHSKTAELFE.NIPNDEIADIIDELDEEEREKVLIAL.ENEDAEEVKELMGYSDESV
DSQ  TGGGAAGATGTTGAGTCTTTAGAAATGATTAATGATAACTTAAAGTTAGCTATTCCATATAAAAAGCTTCAAAAATTACATCCAGCT...GACTTAGCAGATATACTTGAAGAACTTGATGCCATAAACAGAAAAAAAGTTTTCGATAGCTTAGAT...GAAGATTTAGCTGCAGATACCTTAGAAGAAATAGAACCAGAAGTACAAAGTAGT......ATAATAAAGGGACTTTCCCATTCTAAAACTGCAGAGCTTTTTGAA...AATATTCCAAATGACGAAATAGCAGACATTATAGATGAACTAGATGAGGAAGAAAGAGAAAAAGTATTAATTGCCTTA...GAAAATGAAGACGCAGAAGAAGTTAAAGAGCTTATGGGATATTCAGATGAATCTGTA
TRN  10010101110011000
NAM  Q8XL02_CLOPE/7-129
ASQ  KEKLKDILAKYPSNKFDSLDDI----HPA.DIVDLLEE--NEENIKLIKKLP.ENMIADIIDFAKDDDKVN..ILKSLPEEKKKKVLN.LIASDELTDLMASLNREETSKLLSSM.PVQDAKDLRKLLTYAPDTA
DSQ  AAAGAAAAGCTAAAGGATATTTTAGCTAAATATCCAAGTAATAAATTTGATTCTCTAGATGATATA------------CATCCAGCT...GATATAGTGGATTTGTTAGAGGAG------AATGAGGAAAATATTAAGCTTATAAAAAAACTTCCA...GAAAATATGATTGCAGATATTATAGATTTTGCGAAGGATGATGACAAGGTAAAT......ATATTAAAAAGTTTACCTGAAGAAAAGAAGAAGAAGGTTTTAAAT...TTAATAGCTTCAGATGAACTTACAGACCTTATGGCAAGCTTAAATCGTGAAGAAACTAGTAAATTACTTTCAAGTATG...CCAGTTCAAGATGCTAAGGATTTAAGAAAATTATTAACATATGCACCAGATACAGCT
TRN  10010101110011000
NAM  Q9K7Y3_BACHD/10-138
ASQ  EEYTFYLHMYLKEQEREKFRDDFLALHPI.DQVEIFSELNVQKRKRVYEWIG.PKEFAPIFRGMERNQQKQ..IVTELKESYTIKMFE.EMAPDDMTDFFEEIPNHLTGYFLDRM.DEQEAYAIKRLMSYEKKTA
DSQ  GAAGAGTATACCTTTTACTTACACATGTATTTAAAAGAACAAGAACGAGAAAAATTTCGCGATGATTTTCTTGCATTACATCCTATT...GATCAAGTGGAGATTTTCTCGGAGTTGAACGTTCAAAAGCGGAAGCGAGTGTATGAATGGATTGGG...CCGAAAGAGTTTGCTCCTATATTTAGAGGGATGGAACGGAACCAACAAAAACAG......ATTGTCACAGAGCTGAAAGAGTCTTACACGATTAAAATGTTCGAA...GAAATGGCACCAGACGATATGACCGACTTTTTTGAGGAGATTCCTAATCATTTGACCGGCTATTTTTTAGATCGTATG...GATGAACAGGAGGCCTATGCCATCAAGCGTTTAATGTCTTATGAGAAAAAGACAGCT
TRN  10010101100011010
NAM  Q99V82_STAAM/15-145
ASQ  LYDETLLDQYLENDDIDQFRDEFLALHTY.EQSEYFEDTTDENRQKIFQYLS.PEEVANFFDQLDIDDDEY.eLLFDKMNATYASHILeEMSYDNAVDILNELTKPKVASLLTLM.NKDDANEIKALLHYDEDTA
DSQ  TTATATGATGAGACATTATTAGATCAATACTTAGAAAATGATGATATTGATCAATTTAGAGATGAATTTCTAGCATTACACACATAT...GAACAAAGTGAGTATTTTGAAGATACTACCGATGAAAATAGACAAAAGATTTTTCAATATTTATCA...CCTGAAGAGGTTGCAAATTTCTTTGATCAATTAGATATTGATGACGATGAATAT...gagTTGCTATTTGATAAAATGAATGCGACATACGCAAGTCACATATTAgaaGAAATGTCATACGATAATGCAGTAGATATTTTAAATGAGTTGACTAAACCAAAAGTTGCTAGTCTTTTAACATTGATG...AATAAAGATGACGCGAATGAAATCAAAGCATTACTTCACTATGATGAGGATACGGCC
TRN  10010101110011000
NAM  Q8CPS5_STAEP/15-145
ASQ  VYDKELFDRLLDQNDIDEFRKEFLELHNY.EQSEYFEDTDDENRQKIFEFLS.PKEVANFFDQLDFDDDDYesLFDNMDATYASHVLE.EMSYDNAVDILNELSKPKVASLLTLM.NKDKANEIKALLHYEEDTA
DSQ  GTATATGATAAAGAATTATTTGATCGATTATTAGATCAAAATGATATAGATGAATTCAGAAAAGAATTTTTAGAATTACATAACTAT...GAACAAAGTGAATACTTTGAAGATACGGATGATGAAAATAGACAAAAAATATTTGAGTTTTTATCA...CCCAAAGAAGTAGCAAATTTCTTTGATCAATTAGACTTTGATGACGATGATTATgagagcCTTTTTGATAATATGGACGCTACCTATGCTAGTCATGTCTTAGAG...GAAATGTCTTACGATAATGCAGTAGATATTTTAAATGAGTTATCTAAACCTAAAGTGGCGAGTTTGCTAACATTAATG...AACAAAGATAAAGCTAATGAAATCAAAGCTTTATTACATTATGAAGAAGATACTGCC
TRN  10010101110011000
NAM  Q8ERS6_OCEIH/15-143
ASQ  QVHIEKVNTALQEGEIEVFRESFLDIHPY.DQAMFFNQQDEEARGQIYTYLS.PEEMSEILINIDLEDVTA..FFEEMDPRYAAMILA.EMPTDDAVDVLNELDKEKVASYLTIM.DQESANEIKQLLHYEEKTA
DSQ  CAAGTGCATATTGAAAAAGTAAATACAGCCCTTCAAGAAGGGGAAATTGAAGTTTTTCGTGAATCATTTTTAGACATTCATCCTTAT...GATCAGGCGATGTTTTTTAATCAACAGGATGAAGAAGCAAGAGGGCAGATATATACGTATTTATCT...CCTGAAGAAATGTCGGAAATACTCATAAACATTGATCTTGAAGATGTAACGGCA......TTTTTTGAGGAGATGGATCCGAGGTATGCTGCAATGATTCTTGCT...GAGATGCCAACCGATGATGCAGTAGATGTTTTAAATGAATTAGATAAAGAAAAAGTAGCCAGTTATCTAACTATTATG...GATCAAGAAAGTGCGAATGAAATTAAACAATTACTGCACTATGAGGAAAAAACTGCC
TRN  10010101100011000
NAM  Q98MM2_RHILO/1-125
ASQ  MNDFS----PVADDEAVAIARILANDHVA.DVVEALNHESRETATDLLCAVP.FERLVEIFDQPELDGAPE..LADALPRAKASKLLT.AMSVDRAADILRELDEPARSELLGAL.APPLRATLLSILGYPEGSA
DSQ  ATGAATGATTTTTCC------------CCCGTGGCGGACGACGAGGCCGTTGCCATCGCCCGCATCCTTGCAAACGACCATGTCGCC...GACGTGGTCGAGGCGCTCAACCATGAATCGCGCGAAACCGCGACGGATCTGCTTTGCGCCGTACCC...TTCGAACGGCTGGTCGAGATCTTCGACCAGCCCGAACTCGACGGTGCGCCCGAA......CTCGCGGACGCCCTGCCCCGCGCTAAGGCAAGCAAGCTGCTCACC...GCCATGTCGGTCGACCGTGCGGCCGACATACTGCGCGAGCTCGACGAGCCGGCGCGATCCGAACTGCTCGGCGCACTG...GCGCCGCCGCTGCGCGCCACTCTGCTTTCCATCCTGGGCTATCCCGAAGGCAGCGCC
TRN  10010111100111011
NAM  Q8UGN7_AGRT5/7-128
ASQ  SQRASKAARLLRSGNA-------GSTTIA.ERVEHLNTLDTDAAVAALLAMP.QAKAVAILDRPELHDAAA..IIAGIPLEQAARFVN.LMSDDRVADVMAEMEEEPRAKLFARL.DRTTALSIKHLMGYPPRTA
DSQ  TCCCAGAGAGCCAGCAAGGCCGCACGTCTTCTCCGCAGCGGAAATGCC---------------------GGTTCCACCACCATTGCA...GAACGTGTCGAGCACCTCAACACGCTTGATACCGACGCAGCCGTCGCTGCCCTGCTTGCCATGCCG...CAGGCAAAGGCCGTGGCCATTCTCGACCGGCCGGAACTGCATGACGCAGCCGCC......ATCATTGCCGGCATTCCCCTTGAACAGGCCGCCCGCTTCGTCAAC...CTGATGTCCGACGACCGCGTCGCCGACGTCATGGCGGAAATGGAAGAAGAGCCGCGTGCCAAGCTGTTTGCCCGGCTG...GACCGCACCACCGCGCTCTCCATCAAACATCTGATGGGTTATCCGCCGCGCACGGCC
TRN  10010101100011011
NAM  Q8PFA5_XANAC/1-125
ASQ  MYDEI----LRLAEGADALTAPLAELNTA.DAVEYLNTLDRDEAAQVLAALP.LLRAVKLLEQPELRDAST..LVASLPAEQAASLLG.QMADDRATDIFHGLDAEQRQPLLWLL.SAEARLSIQALMRYPPNTA
DSQ  ATGTACGACGAAATC------------CTGCGCCTTGCCGAAGGCGCCGATGCACTGACCGCACCCCTGGCCGAGCTCAACACGGCC...GATGCGGTGGAATATCTCAACACCCTTGATCGCGACGAAGCGGCGCAGGTGCTGGCCGCGTTGCCT...TTGCTGCGTGCGGTGAAATTGCTCGAACAGCCGGAGCTGCGCGATGCCAGCACG......CTGGTGGCGTCGCTACCGGCCGAGCAGGCCGCCTCGCTGCTCGGG...CAGATGGCCGACGACCGCGCCACCGACATCTTCCATGGCCTGGATGCCGAACAGCGCCAGCCGCTGCTGTGGCTGCTC...AGCGCCGAGGCGCGGCTGTCGATCCAGGCGCTGATGCGCTATCCGCCCAACACCGCC
TRN  11011101101011011
NAM  Q8FVG5_BRUSU/12-135
ASQ  AEVLN-----VADLPAAAIASRITDMRTG.DAVEIVNELDADDAVAVIAQLS.HDDAIRLLDQPELHRAAE..IVAALQPGLASLLLD.GMSADRATDVFQELEDVDRARLFPIL.APETKAALKKLMGYPPNTA
DSQ  GCGGAAGTGCTCAAC---------------GTTGCCGACCTCCCTGCTGCCGCCATTGCAAGCCGCATCACGGATATGCGCACCGGC...GACGCAGTTGAAATCGTCAACGAACTGGATGCCGATGATGCAGTCGCCGTCATTGCCCAGCTTTCG...CACGACGACGCTATCCGCCTGCTGGACCAGCCGGAACTGCATCGCGCGGCCGAA......ATCGTCGCAGCGCTCCAGCCCGGTCTCGCAAGCCTCCTGCTCGAC...GGTATGTCGGCCGACCGCGCCACTGACGTTTTTCAGGAACTCGAAGACGTCGACCGCGCCCGTCTGTTTCCCATTCTC...GCGCCTGAAACGAAGGCTGCGCTGAAAAAGCTGATGGGCTATCCGCCGAATACGGCA
TRN  11011101101011011
NAM  O06312_MYCTU/7-136
ASQ  ENSTLDIRHVIGIGTPKAVDLWLDVVTELpDRARELGSLSKAELGKLGPLLD.GTNAVELFESIDDKLAAE..ALHAMDPSLAATFLE.ALDSDHAANILREFKEPKREALLTLL.PLERAMVLRGLLSWPEDCA
DSQ  GAGAACTCAACACTCGACATCCGCCACGTCATCGGTATCGGCACCCCGAAAGCCGTCGATTTGTGGCTCGACGTCGTCACCGAGCTGccgGATCGCGCCCGCGAACTCGGGTCGTTATCCAAAGCCGAACTCGGAAAGCTTGGCCCACTGCTCGAC...GGCACCAACGCCGTCGAGCTATTCGAGTCGATCGACGACAAGCTGGCCGCAGAG......GCACTGCACGCGATGGATCCGTCGCTGGCCGCCACCTTCCTCGAG...GCCCTCGACTCCGACCACGCCGCCAACATCCTGCGCGAATTCAAGGAGCCCAAGCGGGAGGCGCTGCTGACGTTGCTA...CCGCTGGAGCGGGCGATGGTGCTGCGTGGCTTGTTGAGCTGGCCGGAGGACTGCGCC
TRN  11011101101011000
NAM  Q9PRD6_UREPA/19-147
ASQ  NFLTQNILKTYEHKDITGLKKLLKSKRID.KIVESLETINDTQIILFVLVATkDGICGDIFKYLNTELKSK..IINDASLQQLRIILF.ELYNDDVIILKNDFPMYTKKILLSL-.DSQQRAAIKQLSEFDEDEA
DSQ  AATTTTCTAACACAAAATATTTTAAAAACTTACGAACATAAAGATATTACAGGACTTAAAAAATTACTAAAATCAAAACGGATTGAT...AAAATTGTTGAAAGTCTTGAAACTATTAATGATACACAAATTATTTTATTTGTATTAGTTGCCACAaaaGATGGAATTTGTGGTGATATTTTTAAATATTTAAATACTGAATTAAAATCAAAA......ATCATAAATGACGCAAGTTTACAGCAATTAAGAATCATTTTATTT...GAACTTTATAATGATGATGTGATTATTTTAAAAAATGATTTTCCTATGTATACTAAAAAAATCTTACTTTCATTA---...GACAGCCAACAAAGAGCAGCTATTAAGCAATTATCTGAATTTGATGAAGATGAAGCT
TRN  10010101110011000
NAM  Q8EHS2_SHEON/11-139
ASQ  KQIVVAIQNILEQRNTAGITALAKERHPA.DIAAVLGSFTQPQQLQFLQLVP.AKFAADLFRYLSDELQAA..LVQQLDKTTLSSLLL.TMAADERADLYNLLEPEQQKLLLPVL.AQAKREDMRTLAAYDKTKV
DSQ  AAGCAAATCGTCGTAGCTATCCAAAATATTTTAGAGCAGCGTAATACAGCAGGCATTACGGCCTTAGCAAAAGAGCGTCACCCCGCG...GATATTGCCGCTGTGCTTGGTAGCTTTACTCAGCCACAACAATTACAGTTTTTACAGCTGGTTCCC...GCAAAATTTGCAGCGGATTTATTTCGTTATTTAAGCGATGAATTACAGGCTGCA......TTGGTGCAACAGTTGGATAAAACCACGCTGTCGTCGCTGTTACTG...ACCATGGCAGCAGATGAGCGCGCAGATCTCTATAACCTGCTCGAACCAGAGCAACAAAAACTGCTATTACCTGTATTA...GCGCAGGCAAAACGAGAGGATATGCGCACCTTGGCTGCCTACGACAAAACCAAAGTC
TRN  11011101101011010
NAM  Q92H85_RICCN/19-147
ASQ  AEIFDQINDLIEDHNYDAAASRLAKLHYA.DLADFLDNLNNKTYKIIIPLLQ.DEIKPETLVSLNAYSKPL..IIETLGIKKSAELIN.KLVIEDAIEVVIDLDDDIKDLILSNL.TKEKKHQITVGCTYPENTV
DSQ  GCTGAAATTTTTGATCAAATTAACGATCTGATCGAAGATCACAATTATGATGCTGCTGCAAGCAGGCTGGCCAAGCTTCATTATGCC...GATTTAGCAGATTTCTTAGATAATCTTAACAATAAAACATATAAAATAATTATTCCTTTATTACAG...GATGAAATTAAGCCTGAAACGTTAGTATCATTAAATGCTTATAGTAAACCTTTA......ATAATAGAAACTTTAGGCATAAAAAAATCTGCAGAATTAATCAAT...AAGCTAGTTATAGAAGATGCTATTGAAGTAGTAATCGATCTAGACGATGATATAAAAGACCTTATCCTAAGTAATCTC...ACTAAAGAAAAAAAACACCAAATTACCGTAGGTTGTACATATCCTGAAAATACGGTA
TRN  10010101100011000
NAM  O84197_CHLTR/14-143
ASQ  FKLEEAFDTLTAGEHSQDLTSIVSVYNPI.DLAYAVSCLPSDSRSILYKNLDsIASKIAFIINTDSASRWA..IFRNLSDGEICALIE.QMPPDEAIWVLDDIPDRRYRRILDLI.DVKKALKIRDLQKHGRNTA
DSQ  TTTAAACTAGAAGAAGCTTTTGATACCCTAACAGCAGGGGAACATTCGCAAGATTTAACATCAATAGTCAGTGTATATAATCCTATT...GACTTAGCGTATGCGGTATCATGTCTACCTTCGGATTCACGCTCTATTCTTTATAAGAATCTCGATagtATAGCTTCCAAGATTGCTTTTATTATTAATACGGATTCCGCTTCGCGATGGGCT......ATTTTCCGCAATCTATCGGATGGAGAAATTTGCGCTCTTATAGAA...CAAATGCCTCCAGACGAAGCGATTTGGGTTCTCGATGATATTCCTGACCGAAGATATCGAAGAATTTTAGATTTAATC...GACGTTAAGAAAGCCTTAAAGATTCGTGATTTACAAAAGCATGGAAGGAATACGGCT
TRN  10010101110011000
NAM  Q9KLC8_VIBCH/8-137
ASQ  SQQIELIATAEESEQTHLLGEMVENGLDEgSIALILEAFPVEQRVRLWRSLP.LEMHIDVLTEMRAEVRIS..VINALSEIELKLTLA.KLDNLSLIEWEDSLPDDIISEALSLI.NRDELELYDQANEFADDEI
DSQ  TCTCAACAAATTGAATTGATTGCCACCGCCGAAGAATCCGAGCAAACCCATCTACTCGGTGAGATGGTGGAAAATGGCTTAGATGAAggcTCGATCGCTCTGATTTTAGAAGCGTTTCCTGTGGAACAACGGGTACGTTTATGGCGCAGTTTGCCA...CTGGAGATGCACATAGATGTGCTAACCGAGATGCGCGCCGAGGTGCGGATTTCG......GTCATTAACGCGCTGTCGGAAATTGAACTCAAACTGACGCTGGCT...AAGCTCGATAACCTGTCACTGATCGAGTGGGAAGACTCGCTACCCGATGACATCATCAGTGAAGCATTAAGCCTTATT...AACCGTGATGAACTTGAGCTATACGACCAAGCCAACGAGTTTGCAGATGACGAAATT
TRN  10010101100011000
NAM  Q8D5W6_VIBVU/8-137
ASQ  PLLIEQIAQAEDAEQIVLLNDSIEHGLESgSIALILESQPVDDRVRLWRALP.LEMHIDVLTDMRADARYS..VINALSEIELKLTLA.KLDNLSLIEWADSLPEEIINEALSLI.QKDELELFDLANKYGDDEL
DSQ  CCCTTACTGATCGAGCAGATTGCACAAGCAGAAGATGCTGAGCAGATCGTTTTGCTCAACGATTCCATCGAGCATGGTCTCGAATCCggcTCGATTGCACTGATTTTAGAATCGCAACCCGTTGATGATCGTGTGCGCTTGTGGCGTGCTTTGCCA...TTGGAAATGCACATTGATGTACTAACCGACATGCGTGCCGACGCGCGCTATTCC......GTCATCAATGCCTTATCTGAGATAGAACTCAAACTCACCTTAGCG...AAACTTGATAACCTTTCGTTGATCGAATGGGCAGATTCATTGCCTGAAGAGATCATCAACGAAGCACTGTCGTTGATT...CAAAAAGATGAACTTGAACTGTTCGACTTAGCGAACAAATACGGTGATGACGAGCTA
TRN  10010101100011000
NAM  Q87GS5_VIBPA/8-137
ASQ  STLIQQIGQAEESDQVATLNESIEAGLEPgAVALILEAFPIEDRVRLWRALP.LELHIDVLTEMRADVRFS..IINALSEVELKLTLA.KLDNLSLIEWADSLPESIINEALALI.EKDELELYDQANEYEDDEL
DSQ  TCCACTCTAATCCAACAAATTGGCCAAGCCGAAGAATCGGATCAAGTCGCAACGCTCAATGAATCTATCGAAGCGGGTCTCGAACCCggcGCGGTTGCGCTTATCCTCGAAGCTTTCCCTATCGAAGACCGTGTTCGGTTATGGAGAGCATTGCCG...TTAGAACTTCATATCGACGTTTTGACAGAGATGCGTGCCGATGTACGTTTCTCT......ATCATCAATGCGTTATCTGAAGTCGAACTCAAACTCACCCTCGCT...AAACTCGACAACTTATCGTTGATCGAATGGGCAGACTCGTTACCAGAATCCATCATCAATGAAGCGCTCGCCTTAATT...GAAAAAGACGAGCTTGAACTGTACGACCAAGCAAATGAATATGAAGACGATGAGCTA
TRN  10010101100011010
NAM  Q8EGN5_SHEON/17-145
ASQ  GQVVQQLTEVEGEEQAEVFSEILNEAEPG.TIALALESLPLDERYERWQQVE.FSERVTVLSLMRADPRMG..ILKQMPDNEVDLLFA.QLSPEDLIEWSDYLPESFTDRALAQM.GERQRQRFELYDQYSENEI
DSQ  GGTCAGGTTGTTCAGCAACTCACTGAAGTTGAAGGTGAAGAACAAGCTGAAGTGTTCAGTGAAATCTTAAATGAAGCTGAGCCAGGC...ACGATTGCATTAGCACTGGAGTCCTTACCTTTAGACGAGCGTTACGAGCGTTGGCAACAGGTTGAG...TTTAGTGAACGTGTGACTGTGCTGAGTTTAATGCGTGCCGATCCCCGTATGGGG......ATCCTCAAGCAGATGCCCGATAACGAGGTCGATCTGCTATTTGCC...CAATTAAGTCCTGAGGATTTAATTGAGTGGAGTGATTATCTCCCCGAAAGCTTTACCGACCGAGCCTTGGCCCAAATG...GGCGAGCGTCAGCGGCAGCGGTTTGAGTTGTACGACCAATATTCTGAAAATGAAATT
TRN  11011111101111110
NAM  O68316_VIBCH/17-133
ASQ  KQLNEFARKLAHSSRRDKWVEKLFKLTEQ.EIHFVLQQLTGEQLAELILLLS.PPRAGHLLCVMDSNALN-..LGLAYANPRVVEKALrSLNEDELHGVFNMMNPINAERYRER-.-----------LRWGEESV
DSQ  AAACAACTCAATGAATTTGCTCGCAAACTCGCGCACTCTTCACGTCGCGATAAGTGGGTGGAAAAACTGTTCAAACTCACCGAACAA...GAAATTCATTTTGTTTTACAACAGCTCACTGGTGAACAACTGGCTGAACTGATCCTGTTGCTATCT...CCTCCCCGTGCAGGTCATTTATTGTGTGTTATGGATAGCAACGCCCTCAAT---......CTTGGCTTGGCTTACGCCAATCCTCGCGTTGTCGAAAAAGCCTTAcgtAGCTTAAATGAAGATGAGCTGCATGGCGTTTTCAACATGATGAATCCGATCAATGCGGAGCGTTATCGTGAACGT---...---------------------------------CTGCGCTGGGGAGAAGAGAGCGTT
TRN  11011101101011000
//