EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03444 - DUF293)
FAM  PF03444
PID  DUF293
DES  Domain of unknown function
IPR  IPR005104
ANO  5
ALN  178
AID  0.416411
APH  (Q9YDD9_AERPE/35-210:0.71103,((O26229_METTH/10-183:0.30662,Y1232_METJA/2-173:0.55246):0.12810,O30125_ARCFU/5-178:0.32962):0.57417,P95951_SULSO/3-175:0.46708);
ATP  (Q9YDD9_AERPE/35-210,((O26229_METTH/10-183,Y1232_METJA/2-173),O30125_ARCFU/5-178),P95951_SULSO/3-175);
ATL  3.06908
DNO  5
DLN  534
DID  0.487943
DPH  (Q9YDD9_AERPE/35-210:0.61303,(O26229_METTH/10-183:0.28418,(O30125_ARCFU/5-178:0.30464,Y1232_METJA/2-173:0.43190):0.07833):0.24666,P95951_SULSO/3-175:0.38319);
DTP  (Q9YDD9_AERPE/35-210,(O26229_METTH/10-183,(O30125_ARCFU/5-178,Y1232_METJA/2-173)),P95951_SULSO/3-175);
DTL  2.34193
RID  0.416411
RPH  (Q9YDD9_AERPE/35-210:0.71103,((O26229_METTH/10-183:0.30662,Y1232_METJA/2-173:0.55246):0.12810,O30125_ARCFU/5-178:0.32962):0.57417,P95951_SULSO/3-175:0.46708);
RTP  (Q9YDD9_AERPE/35-210,((O26229_METTH/10-183,Y1232_METJA/2-173),O30125_ARCFU/5-178),P95951_SULSO/3-175);
RTL  3.06908
LNK  O26229_METTH/10-183:O26229:AE000802
LNK  O30125_ARCFU/5-178:O30125:AE001099
LNK  P95951_SULSO/3-175:P95951:Y08257
LNK  Q9YDD9_AERPE/35-210:Q9YDD9:BA000002
LNK  Y1232_METJA/2-173:Q58629:U67564
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  P95951_SULSO/3-175
ASQ  NLSPTQREILLALTDLYNRQK-RMIKSKEVADIIGKDEGTVRNIILSLKVLGLVESKPGPNGGYMPTLKAYEIINNPTLTPI----LDKLNLYKGMIETDIKVENIEIIDITNPSANRVLLKVEGDLRKLKIGDAVRLGPTPYSRLVIEGLILHLDENSKEIVVDVKRMISIPKEKVK
DSQ  AATCTCTCGCCTACGCAAAGGGAAATATTGTTAGCACTTACTGATCTATATAATAGGCAAAAA---AGAATGATAAAAAGTAAGGAAGTAGCTGACATTATAGGAAAAGATGAGGGAACAGTAAGGAACATTATACTAAGCTTAAAAGTATTAGGCCTAGTTGAATCGAAACCCGGACCTAATGGAGGTTACATGCCAACACTAAAAGCATATGAAATTATTAATAATCCTACACTAACTCCAATT------------TTGGATAAACTAAATCTCTATAAAGGGATGATAGAAACTGATATAAAAGTAGAAAATATTGAAATAATTGATATTACTAACCCTTCAGCGAATAGGGTTCTCTTAAAGGTAGAGGGAGATCTAAGGAAATTAAAGATAGGAGATGCTGTACGGTTAGGTCCTACACCCTATAGTAGGCTGGTTATAGAAGGATTGATATTACACTTAGATGAAAATAGTAAAGAAATCGTAGTAGACGTGAAAAGAATGATAAGTATCCCTAAGGAAAAAGTCAAA
TRN  10010101100011000
NAM  Q9YDD9_AERPE/35-210
ASQ  MLTSLQREVLETLVSLYERHK-RMIKSKEVAEALGKDEGTVRNVIMWLKSLGLVESRTGPAGGYMPTLKAYEVIGVQTPTLSHVTYGQVIVEKDGNQYR-YAALDMEIMGIFGSDTMKAVVTVSGNIAPIEKGDLVRVESVPVRKFALEGRVEKVSREARQLMIVISKMTVIPNIKVN
DSQ  ATGCTAACCAGCCTCCAGAGGGAGGTCCTGGAGACTCTTGTGTCGCTCTACGAGAGGCACAAG---AGGATGATTAAGAGTAAGGAGGTTGCGGAGGCCCTAGGGAAGGATGAGGGGACGGTTAGGAACGTTATAATGTGGCTCAAGAGTCTTGGGCTGGTGGAGAGTCGAACGGGCCCGGCGGGGGGCTACATGCCCACGTTGAAGGCCTACGAGGTCATAGGCGTTCAGACACCCACCCTCAGCCACGTAACCTACGGTCAGGTCATAGTTGAGAAGGATGGAAACCAGTACCGC---TACGCAGCCCTCGACATGGAGATAATGGGGATATTCGGGAGTGACACTATGAAGGCTGTTGTCACGGTTTCAGGCAACATAGCTCCCATAGAGAAGGGTGATCTGGTTAGGGTTGAGAGCGTGCCTGTAAGGAAGTTCGCCCTCGAGGGGAGGGTTGAGAAGGTTAGCAGGGAGGCCAGGCAGCTCATGATAGTTATATCGAAGATGACTGTAATACCGAACATCAAGGTGAAC
TRN  10010101100011001
NAM  O26229_METTH/10-183
ASQ  MLTSVQKEILQTLINLYRNSNGKSIKGEEIAAIMNRNPGTIRNQMQSLRSLGLVKGVPGPRGGYKPTIKAYHQLNISSTGRE----TAVPIYRDGEQIEDLSVAKIEFTSIPDPGECEAAIKLVGSIRKLDLGDRVRIGPTPVNKLVVDGVVVGRDDMDNIILLDTTAIRSIPKKTVA
DSQ  ATGCTTACCTCTGTTCAGAAGGAGATACTTCAGACACTCATTAACCTTTACCGGAACTCAAATGGCAAGTCAATCAAGGGGGAGGAGATAGCCGCCATAATGAACCGGAACCCCGGCACAATAAGGAACCAGATGCAGTCCCTCAGAAGTCTGGGTCTTGTTAAGGGGGTGCCTGGACCCCGGGGGGGCTACAAGCCAACAATAAAGGCCTACCACCAGCTGAACATATCCTCAACAGGCAGGGAG------------ACCGCTGTACCGATTTACAGGGACGGGGAGCAGATTGAGGACCTATCAGTGGCTAAAATTGAATTCACCAGCATACCTGATCCCGGTGAGTGCGAAGCCGCCATAAAACTTGTTGGAAGTATAAGGAAACTTGACCTCGGTGACAGGGTGCGGATAGGTCCAACCCCTGTTAACAAGCTTGTGGTTGATGGTGTGGTTGTCGGAAGAGACGATATGGATAACATCATCCTCCTCGATACAACCGCTATAAGAAGCATACCCAAGAAGACCGTTGCT
TRN  10010101100011001
NAM  O30125_ARCFU/5-178
ASQ  DLTQIQKDILYALITLYKKKSGGSVKGEEIAELINRNPGTVRNQMQALRALGLVEGVPGPKGGYRPTSKAYELLSVTRPEES----VVVPVVVNGNVMEELSAEEIVLPSISNPNICQARIRIIGDIKKINPGDSVIVGPTPVNEMMVYGKVVGRDDTENTIVLDIEKIVALPKDTVG
DSQ  GATTTGACCCAGATTCAGAAGGACATACTGTATGCTTTGATAACGCTGTATAAGAAGAAATCTGGCGGATCGGTGAAAGGAGAGGAGATTGCAGAACTCATTAACAGAAATCCCGGAACCGTAAGAAACCAGATGCAGGCTTTAAGGGCACTGGGGCTTGTGGAGGGTGTACCGGGACCGAAAGGTGGTTACAGACCGACTTCAAAGGCCTACGAGCTTCTGTCAGTAACGAGACCGGAGGAATCC------------GTTGTTGTTCCGGTAGTCGTAAACGGAAACGTTATGGAGGAGCTCTCTGCGGAAGAGATCGTTTTGCCCTCTATATCAAATCCAAACATCTGTCAAGCGAGAATAAGGATTATTGGAGATATCAAGAAGATTAATCCGGGAGACAGCGTAATTGTAGGCCCCACACCCGTCAACGAGATGATGGTTTACGGAAAGGTGGTTGGTAGGGATGACACCGAGAACACGATCGTACTCGACATTGAGAAAATCGTCGCTCTGCCGAAGGACACGGTTGGC
TRN  10010101100011000
NAM  Y1232_METJA/2-173
ASQ  ELTVVQREILQELINLYREKN-RPIKGTEIALRLNRNPGTIRNQMQALRALDLVDGVPGPKGGYVPTSKAYRALGLEDEGE-----IIVPIYKDGKKVEGVKVVKIEFDTVSHEKCCSSKIHIEGDTKHFNIGDIIRVGPTYHNKIIINGKIIGRDDIHRILLIDVLGVSSIPNIKVG
DSQ  GAACTAACGGTTGTGCAGAGAGAGATATTACAAGAACTTATAAACCTATATAGAGAAAAAAAT---AGACCAATCAAAGGAACAGAAATTGCCTTAAGATTAAATAGGAATCCAGGAACTATAAGAAACCAAATGCAAGCTTTAAGGGCATTAGATTTAGTTGATGGTGTTCCTGGACCTAAAGGGGGATATGTGCCAACAAGTAAAGCTTATAGAGCTTTGGGATTAGAAGATGAGGGGGAG---------------ATAATAGTCCCTATATATAAAGATGGAAAGAAAGTTGAGGGAGTTAAGGTTGTAAAAATAGAGTTTGACACTGTTTCACATGAAAAATGCTGTTCTTCAAAGATACACATTGAGGGGGATACAAAGCACTTTAACATTGGAGATATTATTAGAGTCGGCCCTACTTATCATAATAAAATTATTATTAATGGAAAAATTATTGGAAGGGATGATATTCATAGGATTTTGCTAATAGATGTTTTAGGAGTTTCAAGTATCCCAAATATAAAAGTTGGA
TRN  10010101110011000
//