EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03440 - APT)
FAM  PF03440
PID  APT
DES  Aerolysin/Pertussis toxin (APT) domain
IPR  IPR005138
ANO  5
ALN  105
AID  0.41497
APH  ((AERA_AERSA/9-108:0.32543,(TOX2_BORPE/14-116:0.30273,TOX3_BORPE/15-117:0.19728):1.62873):0.24974,AER3_AERHY/8-106:0.00000,AERA_AERTR/8-106:0.22473);
ATP  ((AERA_AERSA/9-108,(TOX2_BORPE/14-116,TOX3_BORPE/15-117)),AER3_AERHY/8-106,AERA_AERTR/8-106);
ATL  2.92864
DNO  5
DLN  315
DID  0.496193
DPH  (TOX2_BORPE/14-116:0.12500,((AERA_AERTR/8-106:0.14454,AERA_AERSA/9-108:0.46437):0.17670,AER3_AERHY/8-106:0.01404):1.05433,TOX3_BORPE/15-117:0.26882);
DTP  (TOX2_BORPE/14-116,((AERA_AERTR/8-106,AERA_AERSA/9-108),AER3_AERHY/8-106),TOX3_BORPE/15-117);
DTL  2.2478
RID  0.41497
RPH  ((AERA_AERSA/9-108:0.32543,(TOX2_BORPE/14-116:0.30273,TOX3_BORPE/15-117:0.19728):1.62873):0.24974,AER3_AERHY/8-106:0.00000,AERA_AERTR/8-106:0.22473);
RTP  ((AERA_AERSA/9-108,(TOX2_BORPE/14-116,TOX3_BORPE/15-117)),AER3_AERHY/8-106,AERA_AERTR/8-106);
RTL  2.92864
LNK  AER3_AERHY/8-106:Q06305:X65044
LNK  AERA_AERSA/9-108:Q08676:X65048
LNK  AERA_AERTR/8-106:P09166:Y00559
LNK  TOX2_BORPE/14-116:P04978:BX640422
LNK  TOX3_BORPE/15-117:P04979:M14378
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  TOX3_BORPE/15-117
ASQ  ILVLALLGMRTAQAV-APGIVIPPKALFTQQGGAYGRCPNGTRALTVAELRGNAELQTYLRQITPGWSIYGLYD-GTYLGQAYGGIIKDAPPGAGFIYRETFCIT
DSQ  ATCCTGGTGCTCGCCCTGCTGGGCATGCGCACGGCCCAGGCCGTT---GCGCCAGGCATCGTCATCCCGCCGAAGGCACTGTTCACCCAACAGGGCGGCGCCTATGGACGCTGCCCGAACGGAACCCGCGCCTTGACCGTGGCCGAACTGCGCGGCAACGCCGAATTGCAGACGTATTTGCGCCAGATAACGCCCGGCTGGTCCATATACGGTCTCTATGAC---GGTACGTACCTGGGCCAGGCGTACGGCGGCATCATCAAGGACGCGCCGCCAGGCGCGGGGTTCATTTATCGCGAAACTTTCTGCATCACG
TRN  10010111100111011
NAM  TOX2_BORPE/14-116
ASQ  VLPLALLGSHVARAS-TPGIVIPPQEQITQHGGPYGRCANKTRALTVAELRGSGDLQEYLRHVTRGWSIFALYD-GTYLGGEYGGVIKDGTPGGAFDLKTTFCIM
DSQ  GTTCTGCCGTTGGCCCTCCTCGGATCTCACGTGGCGCGGGCCTCC---ACGCCAGGCATCGTCATTCCGCCGCAGGAACAGATTACCCAGCATGGCGGCCCCTATGGACGCTGCGCGAACAAGACCCGTGCCCTGACCGTGGCGGAATTGCGCGGCAGCGGCGATCTGCAGGAGTACCTGCGTCATGTGACGCGCGGCTGGTCAATATTTGCGCTCTACGAT---GGCACCTATCTCGGCGGCGAATATGGCGGCGTGATCAAGGACGGAACACCCGGCGGCGCATTCGACCTGAAAACGACGTTCTGCATCATG
TRN  10010101100011001
NAM  AERA_AERTR/8-106
ASQ  GLSLIISATLAAQTN-AAEPIYPDQLRLFSLG--EDVCGTDYRPINREEAQS---VRNNIVAMMGQWQISGLANNWVILGPGYNGEIKPGKASTTWCYPTRPATA
DSQ  GGCTTGTCATTAATCATTTCCGCCACGCTGGCCGCCCAGACCAAT---GCTGCAGAGCCCATCTATCCTGACCAGCTGCGGCTGTTCTCTCTTGGG------GAAGATGTCTGCGGTACTGATTATCGTCCAATTAACCGGGAAGAAGCACAGAGT---------GTCCGGAATAATATTGTGGCCATGATGGGGCAGTGGCAAATCAGTGGGTTGGCCAATAACTGGGTTATTCTTGGGCCAGGTTATAACGGTGAAATAAAACCGGGTAAAGCATCGACAACCTGGTGTTATCCCACTCGTCCCGCCACGGCA
TRN  10010101100011000
NAM  AER3_AERHY/8-106
ASQ  GLSLIISGLLMAQAQ-AAEPVYPDQLRLFSLG--QEVCGDKYRPVNREEAQS---VKSNIVGMMGQWQISGLANGWVIMGPGYNGEIKPGSASSTWCYPTNPATG
DSQ  GGCTTGTCATTAATCATATCCGGCCTGCTGATGGCACAGGCGCAA---GCGGCAGAGCCCGTCTATCCAGACCAGCTTCGTCTGTTTTCACTGGGG------CAAGAGGTCTGTGGCGACAAGTATCGCCCCGTCAATCGAGAAGAGGCGCAGAGC---------GTCAAAAGCAATATTGTCGGCATGATGGGACAATGGCAAATAAGCGGACTCGCCAACGGCTGGGTCATTATGGGACCCGGGTATAATGGTGAAATAAAACCAGGATCAGCGTCCAGCACTTGGTGCTATCCGACCAATCCTGCTACCGGA
TRN  10010101100011000
NAM  AERA_AERSA/9-108
ASQ  NLANLASSLMLAQVLGWHEPVYPDQVKWAGLG--TGVCASGYRPLTRDEAMS---IKGNLVSRMGQWQITGLADRWVIMGPGYNGEIKQGTAGETWCYPNSPVSG
DSQ  AATCTGGCGAATTTGGCGTCTTCATTGATGCTCGCTCAGGTGCTAGGCTGGCATGAACCTGTCTACCCTGATCAGGTCAAGTGGGCGGGTCTTGGC------ACGGGCGTCTGTGCCAGTGGTTATCGTCCTCTTACCCGTGATGAAGCTATGAGT---------ATCAAGGGTAATCTGGTCAGCCGCATGGGGCAGTGGCAGATCACTGGGCTGGCTGATCGCTGGGTGATTATGGGGCCTGGATATAATGGCGAAATCAAACAGGGCACTGCCGGAGAGACCTGGTGTTATCCCAACTCACCGGTTTCAGGA
TRN  11011101101011001
//