EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03423 - CBM_25)
FAM  PF03423
PID  CBM_25
DES  Carbohydrate binding domain (family 25)
IPR  IPR005085
ANO  9
ALN  87
AID  0.467931
APH  ((P96992_STRLI/156-241:0.35444,(P96992_STRLI/48-133:0.28367,(O24781_BACSP/510-594:0.26975,O24781_BACSP/611-696:0.29749):0.20988):0.11690):0.31451,(((Q03658_9BACT/1190-1274:0.17748,Q03658_9BACT/1086-1170:0.17014):0.12535,Q03658_9BACT/983-1067:0.22025):0.26896,AMYB_PAEPO/464-548:0.15441):0.28919,Q45574_BACSP/869-953:0.57485);
ATP  ((P96992_STRLI/156-241,(P96992_STRLI/48-133,(O24781_BACSP/510-594,O24781_BACSP/611-696))),(((Q03658_9BACT/1190-1274,Q03658_9BACT/1086-1170),Q03658_9BACT/983-1067),AMYB_PAEPO/464-548),Q45574_BACSP/869-953);
ATL  3.82726
DNO  9
DLN  261
DID  0.519378
DPH  (((((((Q03658_9BACT/1190-1274:0.15913,Q03658_9BACT/1086-1170:0.13302):0.10125,Q03658_9BACT/983-1067:0.15488):0.26128,AMYB_PAEPO/464-548:0.18326):0.20966,Q45574_BACSP/869-953:0.43561):0.26693,P96992_STRLI/156-241:0.22500):0.05610,P96992_STRLI/48-133:0.20836):0.14483,O24781_BACSP/611-696:0.21543,O24781_BACSP/510-594:0.18102);
DTP  (((((((Q03658_9BACT/1190-1274,Q03658_9BACT/1086-1170),Q03658_9BACT/983-1067),AMYB_PAEPO/464-548),Q45574_BACSP/869-953),P96992_STRLI/156-241),P96992_STRLI/48-133),O24781_BACSP/611-696,O24781_BACSP/510-594);
DTL  2.93576
RID  0.467931
RPH  ((P96992_STRLI/156-241:0.35444,(P96992_STRLI/48-133:0.28367,(O24781_BACSP/510-594:0.26975,O24781_BACSP/611-696:0.29749):0.20988):0.11690):0.31451,(((Q03658_9BACT/1190-1274:0.17748,Q03658_9BACT/1086-1170:0.17014):0.12535,Q03658_9BACT/983-1067:0.22025):0.26896,AMYB_PAEPO/464-548:0.15441):0.28919,Q45574_BACSP/869-953:0.57485);
RTP  ((P96992_STRLI/156-241,(P96992_STRLI/48-133,(O24781_BACSP/510-594,O24781_BACSP/611-696))),(((Q03658_9BACT/1190-1274,Q03658_9BACT/1086-1170),Q03658_9BACT/983-1067),AMYB_PAEPO/464-548),Q45574_BACSP/869-953);
RTL  3.82726
LNK  AMYB_PAEPO/464-548:P21543:M15817
LNK  O24781_BACSP/510-594:O24781:AB006823
LNK  O24781_BACSP/611-696:O24781:AB006823
LNK  P96992_STRLI/156-241:P96992:Z86113
LNK  P96992_STRLI/48-133:P96992:Z86113
LNK  Q03658_9BACT/1086-1170:Q03658:X53373
LNK  Q03658_9BACT/1190-1274:Q03658:X53373
LNK  Q03658_9BACT/983-1067:Q03658:X53373
LNK  Q45574_BACSP/869-953:Q45574:X55452
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q45574_BACSP/869-953
ASQ  YYKT--SWTNPHIHYSLNQEAWTTLPGVPLNSSEYEGYAKITIETEEGSQLRAAFNNGRGQWDNNQGRDYVFHSGINTLADGVIVRG
DSQ  TACTATAAGACT------AGTTGGACCAATCCACACATTCATTACTCTCTCAACCAAGAAGCTTGGACCACTTTGCCAGGGGTGCCGCTAAATTCGTCGGAGTATGAAGGCTACGCGAAAATAACAATTGAAACAGAAGAGGGAAGCCAGCTCAGGGCAGCTTTTAATAATGGGCGTGGACAATGGGACAACAATCAGGGAAGAGACTACGTCTTCCATTCAGGAATAAATACATTAGCAGATGGCGTGATAGTCAGGGGC
TRN  10010101110011000
NAM  P96992_STRLI/156-241
ASQ  YSTRTLGWTTANIHYRPAGGSWTAVPGVGMR-AACAGWWKKDVDLGAATSLTAAFNNGNGVWDNNKGADYTLPAGVTTVADNTVTAD
DSQ  TACTCCACCCGTACCCTCGGCTGGACCACCGCCAACATCCACTACCGGCCCGCCGGCGGCTCCTGGACCGCCGTCCCCGGCGTCGGCATGCGG---GCCGCCTGCGCGGGCTGGTGGAAGAAGGACGTCGACCTGGGCGCGGCCACCTCGTTGACGGCCGCCTTCAACAACGGCAACGGGGTGTGGGACAACAACAAGGGCGCCGACTACACCCTGCCGGCCGGCGTCACGACCGTCGCCGACAACACGGTCACCGCCGAC
TRN  11011111101111111
NAM  P96992_STRLI/48-133
ASQ  YYTKTKNWDRYNLHYAPDGGSWTEVPGVAME-AACTDWVKRTVPLGSAEGLRATFNNGSGTWDNNGGENYALGTGALTVKDGVVAHS
DSQ  TACTACACGAAGACGAAGAACTGGGACCGGTACAACCTGCACTACGCACCCGACGGCGGCTCCTGGACCGAGGTCCCCGGCGTGGCGATGGAG---GCCGCGTGCACGGACTGGGTGAAGAGGACGGTCCCCCTGGGCAGCGCCGAGGGGCTGCGGGCCACCTTCAACAACGGCTCGGGCACCTGGGACAACAACGGGGGCGAGAACTACGCCCTCGGCACCGGAGCCCTCACGGTCAAGGACGGCGTGGTCGCGCACTCC
TRN  10010101100011011
NAM  O24781_BACSP/510-594
ASQ  YYSTSKGWSDYKIHYRVGTGAWTTAPGAGMT-AACAGWVSYTVPAG-STGATAAFNNGSGTWDNNNTSNYALSGAVSTVNGGVVGHT
DSQ  TACTACTCGACGTCGAAGGGCTGGAGCGACTACAAGATCCACTACCGCGTGGGTACCGGCGCCTGGACCACCGCTCCCGGTGCCGGCATGACG---GCCGCCTGCGCCGGCTGGGTCTCGTACACCGTCCCGGCCGGC---TCCACCGGAGCCACCGCCGCCTTCAACAACGGCAGCGGCACCTGGGACAACAACAACACCAGCAACTACGCACTCAGCGGCGCGGTCAGCACAGTGAACGGCGGCGTCGTGGGGCATACG
TRN  11011111111111111
NAM  O24781_BACSP/611-696
ASQ  FYSTNKGWSAYNIHYRVGTGAWTTAPGSAMT-AACTGWMTASIPLGGASGITAAFNNGAGTWDNNAGADYSVGSGYRQVKDGVVSTG
DSQ  TTCTACTCCACCAACAAGGGCTGGTCCGCCTACAACATCCACTACCGCGTGGGTACGGGCGCCTGGACCACCGCGCCGGGCAGCGCCATGACG---GCCGCGTGCACCGGCTGGATGACCGCCTCCATCCCCCTGGGCGGAGCCTCCGGAATCACCGCTGCCTTCAACAATGGCGCGGGCACCTGGGATAACAACGCCGGCGCCGATTACAGCGTTGGCAGCGGTTACCGGCAGGTGAAGGACGGCGTGGTCAGCACGGGA
TRN  11011111101111111
NAM  Q03658_9BACT/1190-1274
ASQ  YYKN--GFDTPYVHYRPEGGTWTNAPGIKMDKSEIAGYSKITLDIGRADRVEVAFNDGRGAWDSDNERNYLFVVGNNTYEPGINGAP
DSQ  TATTATAAAAAT------GGTTTTGATACACCGTATGTTCATTATCGTCCAGAAGGTGGTACGTGGACAAATGCACCAGGAATAAAAATGGATAAGTCAGAAATAGCAGGTTACAGTAAAATAACGCTTGATATTGGTCGCGCAGATCGAGTAGAAGTAGCCTTTAATGACGGTCGTGGTGCATGGGATAGTGATAACGAACGTAATTATCTCTTTGTAGTCGGTAACAATACTTATGAACCAGGAATTAACGGCGCACCT
TRN  10010101110011001
NAM  Q03658_9BACT/1086-1170
ASQ  YYQN--GFDTPYVHYRPEGGNWTNAPGLKMEDSEFASYSRLTLDIGEANRAEVAFNNGRGLWDSDNENNYFFNIGDNTYIPGKNGSA
DSQ  TACTATCAAAAT------GGCTTTGATACGCCGTATGTTCATTACCGCCCAGAAGGCGGAAATTGGACCAACGCCCCAGGATTAAAAATGGAAGATTCAGAGTTTGCAAGTTATAGTAGGTTAACGCTTGATATTGGTGAAGCTAATCGTGCAGAAGTGGCTTTCAATAACGGACGCGGCCTTTGGGATAGTGATAATGAAAATAATTATTTCTTCAATATTGGCGATAACACTTATATACCAGGAAAAAACGGTTCAGCT
TRN  10010101110011000
NAM  Q03658_9BACT/983-1067
ASQ  YYKK--GFDTPYMHYRPEGGEWTIVPGIRMEESEIAGYSKLTVDIREASKLEVAFNNGRGAWDSDQENNYLFEPGVHTYIPSHEGRG
DSQ  TACTATAAAAAA------GGCTTTGATACCCCATATATGCATTATCGTCCGGAAGGTGGAGAGTGGACGATCGTTCCAGGAATTAGAATGGAAGAATCAGAAATAGCAGGCTATAGTAAGTTAACCGTTGATATTCGGGAAGCAAGCAAGTTGGAAGTAGCCTTTAATAATGGACGTGGGGCTTGGGATAGTGATCAAGAGAATAATTATTTATTTGAGCCAGGTGTTCATACGTACATTCCGAGTCATGAAGGAAGAGGA
TRN  10010101110011000
NAM  AMYB_PAEPO/464-548
ASQ  YYKK--GFNSPYIHYRPAGGSWTAAPGVKMQDAEISGYAKITVDIGSASQLEAAFNDGNNNWDSNNTKNYSFSTGTSTYTPGNSGNA
DSQ  TACTATAAAAAA------GGCTTCAACTCGCCTTACATTCACTACCGTCCGGCTGGTGGTAGCTGGACTGCTGCACCTGGTGTGAAAATGCAGGATGCCGAAATTAGCGGCTATGCTAAAATTACCGTCGATATCGGTTCTGCCTCCCAATTGGAAGCCGCTTTTAACGACGGCAATAACAACTGGGACAGCAACAACACCAAAAACTACTCCTTCAGCACGGGCACTTCTACGTACACGCCCGGTAATAGTGGCAATGCA
TRN  11111101111011011
//