EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03414 - Glyco_transf_6)
FAM  PF03414
PID  Glyco_transf_6
DES  Glycosyltransferase family 6
IPR  IPR005076
ANO  6
ALN  341
AID  0.499499
APH  ((((Q28855_9PRIM/39-374:0.08598,GGTA1_BOVIN/39-366:0.12523):0.13980,GGTA1_MOUSE/62-392:0.08985):0.67313,Q95158_CANFA/10-347:0.49645):0.31843,O77563_PIG/27-363:0.27445,BGAT_HUMAN/17-353:0.22772);
ATP  ((((Q28855_9PRIM/39-374,GGTA1_BOVIN/39-366),GGTA1_MOUSE/62-392),Q95158_CANFA/10-347),O77563_PIG/27-363,BGAT_HUMAN/17-353);
ATL  2.43105
DNO  6
DLN  1023
DID  0.578046
DPH  (O77563_PIG/27-363:0.23019,(Q95158_CANFA/10-347:0.36369,(GGTA1_MOUSE/62-392:0.09243,(Q28855_9PRIM/39-374:0.06215,GGTA1_BOVIN/39-366:0.11063):0.08300):0.44960):0.18233,BGAT_HUMAN/17-353:0.16844);
DTP  (O77563_PIG/27-363,(Q95158_CANFA/10-347,(GGTA1_MOUSE/62-392,(Q28855_9PRIM/39-374,GGTA1_BOVIN/39-366))),BGAT_HUMAN/17-353);
DTL  1.74246
RID  0.499499
RPH  ((((Q28855_9PRIM/39-374:0.08598,GGTA1_BOVIN/39-366:0.12523):0.13980,GGTA1_MOUSE/62-392:0.08985):0.67313,Q95158_CANFA/10-347:0.49645):0.31843,O77563_PIG/27-363:0.27445,BGAT_HUMAN/17-353:0.22772);
RTP  ((((Q28855_9PRIM/39-374,GGTA1_BOVIN/39-366),GGTA1_MOUSE/62-392),Q95158_CANFA/10-347),O77563_PIG/27-363,BGAT_HUMAN/17-353);
RTL  2.43105
LNK  BGAT_HUMAN/17-353:P16442:AF134412
LNK  GGTA1_BOVIN/39-366:P14769:J04989
LNK  GGTA1_MOUSE/62-392:P23336:M26925
LNK  O77563_PIG/27-363:O77563:AF050177
LNK  Q28855_9PRIM/39-374:Q28855:S71333
LNK  Q95158_CANFA/10-347:Q95158:U66140
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  BGAT_HUMAN/17-353
ASQ  LRPMILFLIMLVLVLFGYGVLSPRSLMPGSLeRGFCM--AVRE-PDHLQRVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVA-FLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVRN
DSQ  CTTCGACCTATGATCCTTTTCCTAATAATGCTTGTCTTGGTCTTGTTTGGTTACGGGGTCCTAAGCCCCAGAAGTCTAATGCCAGGAAGCCTGgaaCGGGGGTTCTGCATG------GCTGTTAGGGAA---CCTGACCATCTGCAGCGCGTCTCGTTGCCAAGGATGGTCTACCCCCAGCCAAAGGTGCTGACACCGTGTAGGAAGGATGTCCTCGTGGTGACCCCTTGGCTGGCTCCCATTGTCTGGGAGGGCACATTCAACATCGACATCCTCAACGAGCAGTTCAGGCTCCAGAACACCACCATTGGGTTAACTGTGTTTGCCATCAAGAAATACGTGGCT---TTCCTGAAGCTGTTCCTGGAGACGGCGGAGAAGCACTTCATGGTGGGCCACCGTGTCCACTACTATGTCTTCACCGACCAGCCGGCCGCGGTGCCCCGCGTGACGCTGGGGACCGGTCGGCAGCTGTCAGTGCTGGAGGTGCGCGCCTACAAGCGCTGGCAGGACGTGTCCATGCGCCGCATGGAGATGATCAGTGACTTCTGCGAGCGGCGCTTCCTCAGCGAGGTGGATTACCTGGTGTGCGTGGACGTGGACATGGAGTTCCGCGACCACGTGGGCGTGGAGATCCTGACTCCGCTGTTCGGCACCCTGCACCCCGGCTTCTACGGAAGCAGCCGGGAGGCCTTCACCTACGAGCGCCGGCCCCAGTCCCAGGCCTACATCCCCAAGGACGAGGGCGATTTCTACTACCTGGGGGGGTTCTTCGGGGGGTCGGTGCAAGAGGTGCAGCGGCTCACCAGGGCCTGCCACCAGGCCATGATGGTCGACCAGGCCAACGGCATCGAGGCCGTGTGGCACGACGAGAGCCACCTGAACAAGTACCTGCTGCGCCACAAACCCACCAAGGTGCTCTCCCCCGAGTACTTGTGGGACCAGCAGCTGCTGGGCTGGCCCGCCGTCCTGAGGAAGCTGAGGTTCACTGCGGTGCCCAAGAACCACCAGGCGGTCCGGAAC
TRN  10010101100011000
NAM  O77563_PIG/27-363
ASQ  FYSNVFSLTPGWQSKESQSPEPQQLQESSLQpESLPLSECDCH-LDTCRIPEVPRLIYPKAQVLKPTRVDVLVMTPWFAPIIWDGTFDSAVLDAQF--RNTTIGLTVFAIKKYVV-FLKLFLETAEKYFMVGHRVNYYIFTDRPADVPQVPLGEGRQVVVLEVRNYSRWQDISMHRMEMIRNFSQQRFLHEVDYLVCVDVDMKFSDHVGVEILAPLFGTLHPGFYAAPRQSFTYERRPLSQAYIPRDEGDFYYAGGFFGGSVPEVQRLTTACHQAMVADKAKGIEAVWHDESHLNRYLLYHKPSKVLSPEYLWDEHMLQRPPFLRKLRYVAVPKNHAEIRN
DSQ  TTCTACAGCAATGTTTTCAGCCTGACTCCCGGGTGGCAGAGCAAAGAGTCTCAAAGCCCCGAGCCCCAGCAGCTGCAGGAGAGCTCTCTCCAAccaGAGAGCCTGCCCTTGAGTGAATGTGACTGCCAC---CTGGACACCTGCAGGATACCCGAAGTACCCAGGTTGATTTACCCCAAGGCCCAGGTCCTCAAACCCACGAGAGTGGACGTGCTGGTCATGACTCCCTGGTTTGCTCCCATCATCTGGGATGGGACCTTTGATTCTGCTGTCCTGGATGCACAGTTC------AGAAACACCACCATTGGCCTGACCGTGTTTGCCATCAAAAAATACGTGGTC---TTCCTGAAGCTGTTCCTGGAGACAGCGGAGAAATACTTCATGGTGGGACACAGGGTCAACTACTACATCTTCACCGACCGGCCAGCTGACGTGCCCCAGGTCCCCCTCGGGGAAGGGAGGCAGGTGGTGGTCCTTGAGGTCCGGAACTACAGTCGCTGGCAGGACATATCCATGCACCGAATGGAGATGATCCGCAACTTCTCCCAGCAGCGCTTCCTCCACGAGGTGGACTACCTCGTGTGCGTGGATGTGGACATGAAGTTCAGCGACCACGTGGGCGTGGAGATCCTGGCCCCCCTCTTCGGAACCCTGCACCCCGGTTTCTACGCAGCTCCCCGCCAGTCCTTCACCTACGAACGCCGGCCCCTGTCTCAGGCTTACATTCCGAGAGATGAGGGCGACTTTTACTACGCAGGAGGCTTTTTTGGGGGGTCAGTCCCTGAGGTGCAGCGGCTCACCACCGCGTGTCACCAGGCCATGGTGGCTGACAAGGCCAAGGGCATCGAGGCTGTGTGGCATGATGAGAGCCACCTGAACAGGTACCTGCTGTACCACAAGCCCAGCAAGGTGCTGTCCCCGGAGTACCTATGGGACGAGCACATGCTGCAGAGACCCCCCTTCCTCAGGAAACTGCGCTACGTGGCGGTGCCCAAGAATCACGCAGAGATTCGGAAC
TRN  10010101100011001
NAM  Q95158_CANFA/10-347
ASQ  LGFSLLSGIALWSLWIYMETWLPFSYVPYYL.PCPEIFNMKLQYKGEKPFQPVTRSPHPQPKLLEQRPTELLTLTPWLAPIVSEGTFNPELLQHIYQPLNLTIGLTVFAVGKYTR-FVQHFLESAEQFFMQGYQVYYYIFTNDPAGIPRVPLGPGRLLSIIPIQRHSRWEEISTRRMETISRHIAQRAHREVDYLFCVDVDMVFRNPWGPETLGDLVAAIHPGYYAVPRQQFPYERRHISTAFVAENEGDFYYGGAVFGGRVAKVYEFTTGCHMAILADKANGIMAAWQEESHLNRRFISHKPSKVLSPEYLWDDRK-PQPPSLKLIRFSTLDKATSWLRS
DSQ  CTCGGATTCAGCCTGCTGTCGGGCATTGCCCTCTGGTCCCTGTGGATTTATATGGAGACCTGGCTGCCCTTCTCCTATGTCCCCTATTATCTC...CCCTGCCCAGAGATCTTCAACATGAAACTGCAGTATAAGGGGGAGAAGCCATTCCAGCCTGTGACACGGTCACCGCACCCTCAGCCCAAGCTCCTAGAGCAGAGGCCTACTGAGCTGCTGACGCTCACACCCTGGTTGGCGCCCATTGTCTCCGAGGGAACCTTCAACCCTGAGCTTCTGCAGCACATCTACCAGCCGCTGAACCTGACCATCGGGCTCACAGTGTTTGCCGTGGGGAAGTATACCCGC---TTCGTCCAGCACTTCCTGGAGTCGGCTGAGCAGTTCTTCATGCAGGGTTACCAGGTGTACTACTATATCTTCACTAATGACCCTGCAGGCATTCCTCGGGTCCCGCTGGGTCCCGGCCGCCTCCTCAGCATCATCCCCATCCAGAGGCACTCCCGCTGGGAGGAGATTTCCACGCGCCGGATGGAGACCATCAGCCGGCATATTGCCCAGAGGGCACACCGCGAGGTGGATTACCTCTTCTGTGTCGACGTGGACATGGTGTTCCGGAACCCATGGGGCCCCGAGACCTTGGGGGACCTAGTGGCTGCAATTCACCCAGGCTACTATGCTGTACCCCGCCAGCAGTTCCCCTACGAGCGCAGGCATATTTCCACAGCCTTTGTGGCAGAGAACGAGGGGGACTTCTATTATGGTGGGGCGGTCTTTGGGGGGCGGGTGGCCAAGGTGTACGAGTTTACCACAGGCTGCCACATGGCCATCCTGGCAGACAAGGCCAATGGCATCATGGCAGCCTGGCAGGAGGAGAGTCACCTGAACCGTCGCTTCATCTCGCACAAGCCCTCCAAAGTGCTGTCCCCTGAGTACCTCTGGGATGACAGGAAG---CCCCAGCCACCTAGCCTGAAGTTGATCCGCTTTTCTACACTGGACAAGGCCACCAGCTGGCTGAGGAGC
TRN  10010101100011001
NAM  GGTA1_MOUSE/62-392
ASQ  RIPEVGENRWQKDWWFPSWFKNGTH------.-SYQEDNVEGRREKGRNGDRI-EEPQLWDWFNPKNRPDVLTVTPWKAPIVWEGTYDTALLEKYYATQKLTVGLTVFAVGKYIEHYLEDFLESADMYFMVGHRVIFYVMIDDTSRMPVVHLNPLHSLQVFEIRSEKRWQDISMMRMKTIGEHILAHIQHEVDFLFCMDVDQVFQDNFGVETLGQLVAQLQAWWYKASPEKFTYERRELSAAYIPFGEGDFYYHAAIFGGTPTHILNLTRECFKGILQDKKHDIEAQWHDESHLNKYFLFNKPTKILSPEYCWDYQI-GLPSDIKSVKVAWQTKEYNLVRN
DSQ  AGAATTCCAGAGGTTGGTGAGAACAGATGGCAGAAGGACTGGTGGTTCCCAAGCTGGTTTAAAAATGGGACCCAC------------------...---AGTTATCAAGAAGACAACGTAGAAGGACGGAGAGAAAAGGGTAGAAATGGAGATCGCATT---GAAGAGCCTCAGCTATGGGACTGGTTCAATCCAAAGAACCGCCCGGATGTTTTGACAGTGACCCCGTGGAAGGCGCCGATTGTGTGGGAAGGCACTTATGACACAGCTCTGCTGGAAAAGTACTACGCCACACAGAAACTCACTGTGGGGCTGACAGTGTTTGCTGTGGGAAAGTACATTGAGCATTACTTAGAAGACTTTCTGGAGTCTGCTGACATGTACTTCATGGTTGGCCATCGGGTCATATTTTACGTCATGATAGACGACACCTCCCGGATGCCTGTCGTGCACCTGAACCCTCTACATTCCTTACAAGTCTTTGAGATCAGGTCTGAGAAGAGGTGGCAGGATATCAGCATGATGCGCATGAAGACCATTGGGGAGCACATCCTGGCCCACATCCAGCACGAGGTCGACTTCCTCTTCTGCATGGACGTGGATCAAGTCTTTCAAGACAACTTCGGGGTGGAAACTCTGGGCCAGCTGGTAGCACAGCTCCAGGCCTGGTGGTACAAGGCCAGTCCCGAGAAGTTCACCTATGAGAGGCGGGAACTGTCGGCCGCGTACATTCCATTCGGAGAGGGGGATTTTTACTACCACGCGGCCATTTTTGGAGGAACGCCTACTCACATTCTCAACCTCACCAGGGAGTGCTTTAAGGGGATCCTCCAGGACAAGAAACATGACATAGAAGCCCAGTGGCATGATGAGAGCCACCTCAACAAATACTTCCTTTTCAACAAACCCACTAAAATCCTATCTCCAGAGTATTGCTGGGACTATCAGATA---GGCCTGCCTTCAGATATTAAAAGTGTCAAGGTAGCTTGGCAGACAAAAGAGTATAATTTGGTTAGAAAT
TRN  10010101100011000
NAM  Q28855_9PRIM/39-374
ASQ  KNPEVDDSSAQKDWWFPGWFNNGIHNYQQ--.EEEDTDKEKGREEEQKKEDDT-TELRLWDWFNPKKRPEVMTVTQWKAPVVWEGTYNKAILENYYAKQKITVGLTVFAIGRYIEHYLEEFVTSANRYFMVGHKVIFYVMVDDVSKAPFIELGPLRSFKVFEVKPEKRWQDISMMRMKTIGEHILAHIQHEVDFLFCMDVDQVFQDHFGVETLGQSVAQLQAWWYKADPDDFTYERRKESAAYIPFGQGDFYYHAAIFGGTPIQVLNITQECFKGILLDKKNDIEAEWHDESHLNKYFLLNKPSKILSPEYCWDYHI-GLPSDIKTVKLSWQTKEYNLVRK
DSQ  AAGAACCCAGAAGTTGATGACAGCAGTGCTCAGAAGGACTGGTGGTTTCCTGGCTGGTTTAACAATGGGATCCACAATTATCAACAA------...GAGGAAGAAGACACAGACAAAGAAAAAGGAAGAGAGGAGGAACAAAAAAAGGAAGATGACACA---ACAGAGCTTCGGCTATGGGACTGGTTTAATCCAAAGAAACGCCCAGAGGTTATGACAGTGACCCAATGGAAGGCGCCGGTTGTGTGGGAAGGCACTTACAACAAAGCCATCCTAGAAAATTATTATGCCAAACAGAAAATTACCGTGGGGTTGACGGTTTTTGCTATTGGAAGATATATTGAGCATTACTTGGAGGAGTTCGTAACATCTGCTAATAGGTACTTCATGGTCGGCCACAAAGTCATATTTTATGTCATGGTGGATGATGTCTCCAAGGCGCCGTTTATAGAGCTGGGTCCTCTGCGTTCCTTCAAAGTGTTTGAGGTCAAGCCAGAGAAGAGGTGGCAAGACATCAGCATGATGCGTATGAAGACCATCGGGGAGCACATCTTGGCCCACATCCAACACGAGGTTGACTTCCTCTTCTGCATGGATGTGGACCAGGTCTTCCAAGACCATTTTGGGGTAGAGACCCTGGGCCAGTCGGTGGCTCAGCTACAGGCCTGGTGGTACAAGGCAGATCCTGATGACTTTACCTATGAGAGGCGGAAAGAGTCGGCAGCATATATTCCATTTGGCCAGGGGGATTTTTATTACCATGCAGCCATTTTTGGAGGAACACCGATTCAGGTTCTCAACATCACCCAGGAGTGCTTTAAGGGAATCCTCCTGGACAAGAAAAATGACATAGAAGCCGAGTGGCATGATGAAAGCCACCTAAACAAGTATTTCCTTCTCAACAAACCCTCTAAAATCTTATCTCCAGAATACTGCTGGGATTATCATATA---GGCCTGCCTTCAGATATTAAAACTGTCAAGCTATCATGGCAAACAAAAGAGTATAATTTGGTTAGAAAG
TRN  10010101100011000
NAM  GGTA1_BOVIN/39-366
ASQ  RNPEVGGSSIQKGWWLPRWFNNGYH------.----EEDGDINEEKEQRNEDE-SKLKLSDWFNPFKRPEVVTMTKWKAPVVWEGTYNRAVLDNYYAKQKITVGLTVFAVGRYIEHYLEEFLTSANKHFMVGHPVIFYIMVDDVSRMPLIELGPLRSFKVFKIKPEKRWQDISMMRMKTIGEHIVAHIQHEVDFLFCMDVDQVFQDKFGVETLGESVAQLQAWWYKADPNDFTYERRKESAAYIPFGEGDFYYHAAIFGGTPTQVLNITQECFKGILKDKKNDIEAQWHDESHLNKYFLLNKPTKILSPEYCWDYHI-GLPADIKLVKMSWQTKEYNVVRN
DSQ  AGAAACCCAGAAGTTGGTGGCAGCAGCATTCAGAAGGGCTGGTGGCTTCCGAGATGGTTTAACAATGGTTACCAT------------------...------------GAAGAAGATGGAGACATAAACGAAGAAAAGGAACAAAGAAACGAAGACGAA---AGCAAGCTTAAGCTATCGGACTGGTTCAACCCATTTAAACGCCCCGAGGTTGTGACCATGACGAAGTGGAAGGCTCCAGTGGTGTGGGAAGGCACTTACAACAGAGCCGTCTTAGACAATTATTATGCCAAGCAGAAAATTACCGTCGGCCTGACGGTTTTCGCCGTCGGAAGATACATTGAGCATTACTTGGAGGAGTTCTTAACGTCTGCTAATAAGCACTTCATGGTGGGCCACCCAGTCATCTTTTATATCATGGTAGATGATGTCTCCAGGATGCCTTTGATAGAGTTGGGTCCTCTGCGCTCCTTCAAAGTGTTTAAGATCAAGCCTGAGAAGAGGTGGCAGGACATCAGCATGATGCGCATGAAGACTATCGGGGAGCACATTGTGGCCCACATCCAGCATGAGGTTGACTTCCTTTTCTGCATGGATGTGGACCAGGTCTTCCAAGACAAGTTTGGGGTGGAGACCCTGGGCGAGTCGGTGGCCCAGCTACAAGCCTGGTGGTACAAGGCAGATCCCAATGACTTCACCTACGAGAGGCGGAAGGAGTCTGCAGCATACATTCCCTTCGGCGAAGGGGATTTTTATTACCATGCAGCCATTTTTGGGGGAACACCCACTCAGGTCCTTAACATCACCCAGGAATGCTTCAAAGGAATCCTCAAGGACAAGAAAAATGACATAGAAGCCCAATGGCATGATGAAAGCCATCTAAACAAGTATTTCCTTCTCAACAAACCTACTAAAATCTTATCCCCGGAATACTGCTGGGATTATCACATA---GGCCTACCTGCGGATATTAAGCTTGTCAAGATGTCTTGGCAGACAAAAGAGTATAATGTGGTTAGAAAT
TRN  10010101100011010
//