EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03391 - Nepo_coat)
FAM  PF03391
PID  Nepo_coat
DES  Nepovirus coat protein, central domain
IPR  IPR005054
ANO  11
ALN  176
AID  0.277474
APH  (POL2_TORVR/1497-1662:1.05193,((POL2_RRVS/768-936:1.15125,COAT_TRSV/179-344:0.75723):0.48522,(((Q88483_9COMO/1003-1166:0.36515,POL2_BRSV/1007-1170:0.14681):0.20834,POL2_GCMV/981-1144:0.21542):0.69449,((Q65029_ARMV/745-916:0.00000,POL2_ARMVS/792-963:0.00000):0.19277,(Q67703_GFLV/166-336:0.01908,POL2_GFLV/771-941:0.02285):0.32467):0.97510):0.07809):0.57624,POL2_BRAV/1268-1433:0.94700);
ATP  (POL2_TORVR/1497-1662,((POL2_RRVS/768-936,COAT_TRSV/179-344),(((Q88483_9COMO/1003-1166,POL2_BRSV/1007-1170),POL2_GCMV/981-1144),((Q65029_ARMV/745-916,POL2_ARMVS/792-963),(Q67703_GFLV/166-336,POL2_GFLV/771-941)))),POL2_BRAV/1268-1433);
ATL  8.21164
DNO  11
DLN  528
DID  0.413743
DPH  (POL2_TORVR/1497-1662:0.71731,((POL2_RRVS/768-936:0.73940,COAT_TRSV/179-344:0.48668):0.24576,(((Q88483_9COMO/1003-1166:0.30100,POL2_BRSV/1007-1170:0.20606):0.16144,POL2_GCMV/981-1144:0.20694):0.40628,((Q65029_ARMV/745-916:0.00000,POL2_ARMVS/792-963:0.00000):0.27864,(Q67703_GFLV/166-336:0.03029,POL2_GFLV/771-941:0.04517):0.22729):0.56375):0.05059):0.20402,POL2_BRAV/1268-1433:0.56640);
DTP  (POL2_TORVR/1497-1662,((POL2_RRVS/768-936,COAT_TRSV/179-344),(((Q88483_9COMO/1003-1166,POL2_BRSV/1007-1170),POL2_GCMV/981-1144),((Q65029_ARMV/745-916,POL2_ARMVS/792-963),(Q67703_GFLV/166-336,POL2_GFLV/771-941)))),POL2_BRAV/1268-1433);
DTL  5.43702
RID  0.277474
RPH  (POL2_TORVR/1497-1662:1.05193,((POL2_RRVS/768-936:1.15125,COAT_TRSV/179-344:0.75723):0.48522,(((Q88483_9COMO/1003-1166:0.36515,POL2_BRSV/1007-1170:0.14681):0.20834,POL2_GCMV/981-1144:0.21542):0.69449,((Q65029_ARMV/745-916:0.00000,POL2_ARMVS/792-963:0.00000):0.19277,(Q67703_GFLV/166-336:0.01908,POL2_GFLV/771-941:0.02285):0.32467):0.97510):0.07809):0.57624,POL2_BRAV/1268-1433:0.94700);
RTP  (POL2_TORVR/1497-1662,((POL2_RRVS/768-936,COAT_TRSV/179-344),(((Q88483_9COMO/1003-1166,POL2_BRSV/1007-1170),POL2_GCMV/981-1144),((Q65029_ARMV/745-916,POL2_ARMVS/792-963),(Q67703_GFLV/166-336,POL2_GFLV/771-941)))),POL2_BRAV/1268-1433);
RTL  8.21164
LNK  COAT_TRSV/179-344:Q88894:L09205
LNK  POL2_ARMVS/792-963:Q65030:X81814
LNK  POL2_BRAV/1268-1433:Q9YK98:AF020051
LNK  POL2_BRSV/1007-1170:P14547:X04062
LNK  POL2_GCMV/981-1144:P13026:X15163
LNK  POL2_GFLV/771-941:P18474:X16907
LNK  POL2_RRVS/768-936:P36324:S46011
LNK  POL2_TORVR/1497-1662:P25247:D12477
LNK  Q65029_ARMV/745-916:Q65029:X81815
LNK  Q67703_GFLV/166-336:Q67703:X60775
LNK  Q88483_9COMO/1003-1166:Q88483:X80831
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  POL2_BRAV/1268-1433
ASQ  PTLVLPQAFGGDLPLDLWRGPYTFPLGGGTKRLSTSLDIGTSTTTVSGWRTVSFPAAYALFLQGHGGSLVGEVVHTGSAAVSCALHLCISFGGAPPTLEEALVFPGFRLPSGEGKFHIKVQTPYGRLSTLTPDCALYVYLAG--------GPIAVAPMSVPYQFCIHLERLVDD--
DSQ  CCCACCCTCGTTTTGCCTCAAGCATTTGGGGGTGATTTACCATTAGATTTGTGGCGTGGCCCCTATACCTTCCCATTAGGGGGGGGTACCAAGCGTTTATCCACTTCGTTGGATATTGGGACGTCGACAACGACCGTTAGTGGGTGGCGTACTGTTTCTTTTCCCGCTGCTTATGCTCTTTTCTTACAAGGGCATGGTGGTAGTTTAGTTGGTGAGGTGGTGCATACTGGTTCGGCCGCTGTGTCATGTGCACTTCACCTTTGTATATCCTTTGGCGGTGCCCCTCCTACTTTGGAGGAAGCACTCGTCTTTCCTGGTTTTCGTTTACCTTCCGGTGAGGGCAAATTTCATATTAAGGTACAAACGCCATATGGGCGATTAAGCACTTTAACTCCAGACTGTGCCTTATATGTTTATTTAGCCGGA------------------------GGACCTATTGCTGTTGCACCAATGTCGGTGCCCTATCAATTCTGCATCCATTTGGAGAGATTGGTAGATGAT------
TRN  10010101110011000
NAM  POL2_TORVR/1497-1662
ASQ  PFITLPHIF-NRLDIGYWRGPTEIDLTSTPAPNAYRLLFGLSTVISGNMSTLNANQALLRFFQGSNGTLHGRIKKIGTALTTCSLLLSLRHKDASLTLETAYQRPHYILA--DGQGAFSLPISTPHAATSFLEDMLRLEIFA------IAGPFSPKDNKAKYQFMCYFDHIELV-E
DSQ  CCTTTTATTACCTTACCCCATATTTTT---AATAGATTAGATATAGGTTATTGGCGCGGGCCAACAGAGATAGATTTAACATCAACTCCCGCACCAAACGCCTATCGTTTACTTTTCGGCTTGTCCACTGTCATTAGTGGTAACATGTCGACTTTGAATGCCAATCAAGCCTTATTGCGTTTTTTCCAGGGCTCGAATGGCACTTTACATGGGCGCATTAAAAAGATAGGGACAGCACTTACAACCTGTTCCCTTTTATTATCGTTGCGCCACAAAGATGCGAGTCTCACATTGGAGACCGCATATCAAAGGCCCCATTACATTTTGGCT------GACGGACAAGGGGCTTTTTCATTACCAATTTCTACCCCCCATGCAGCAACCTCCTTTTTAGAGGACATGTTGCGCCTGGAGATTTTTGCT------------------ATTGCTGGGCCTTTTAGTCCCAAAGATAATAAAGCAAAATACCAATTCATGTGTTATTTCGATCACATAGAATTGGTT---GAG
TRN  10010101100011000
NAM  POL2_RRVS/768-936
ASQ  PTFVWPPKP-TDISLLKEVWGPYRFTLDGTEAKESFAIMPGTAILHGQQIVRTFPRVVAAHFRSWTGKVRMSIQEVSSIFLTGTYMVGVSW-NATADLADIVTRKHWIVKS-NEIFEVDLYCPYGENPTFTGQANGKPFIIVHK----LGGIVGPKDSVGTFGFMIHIHGLTGVYK
DSQ  CCTACTTTTGTATGGCCCCCGAAGCCG---ACTGATATATCTCTTCTTAAGGAAGTATGGGGGCCATACCGTTTTACGCTGGATGGTACCGAGGCCAAAGAAAGTTTTGCTATAATGCCCGGTACAGCTATTCTCCATGGGCAGCAGATTGTGCGCACATTTCCCCGAGTCGTTGCCGCACACTTCCGATCATGGACTGGAAAGGTCAGGATGTCCATTCAAGAGGTTTCCTCTATTTTCCTGACCGGAACATATATGGTTGGTGTGTCCTGG---AATGCTACTGCGGATCTCGCCGACATCGTCACTCGGAAACATTGGATTGTAAAGTCC---AATGAGATTTTTGAGGTGGACTTATATTGTCCATATGGTGAGAATCCTACCTTTACGGGTCAGGCCAATGGAAAGCCATTCATCATAGTGCATAAA------------CTTGGTGGAATCGTTGGGCCCAAGGACTCAGTTGGGACGTTTGGTTTTATGATACACATACACGGCTTGACTGGTGTATATAAG
TRN  10010101100011000
NAM  COAT_TRSV/179-344
ASQ  PTMTWPIQL-GDTFAIDRYYEAKEIKLDGSTSMLSISYNFGGPVKHSKKHAISYSRAVMSRNLGWSGTISGSVKSVSSLFCTASFVIFPWECEAPPTLRQVLWGPHQIMHG-DGQFEIAIKTRLHSAAT-TEEGFGRLGILP------LSGPIAPDAHVGSYEFIVHINTWRPD-S
DSQ  CCAACTATGACGTGGCCTATTCAATTG---GGTGATACTTTCGCCATTGATAGATATTATGAGGCGAAAGAGATTAAACTTGATGGGTCAACCTCCATGTTGTCCATATCTTATAATTTTGGAGGTCCCGTTAAGCATTCTAAGAAACATGCCATTTCATATTCCCGGGCAGTTATGTCTAGGAATCTTGGGTGGTCTGGCACTATAAGCGGAAGTGTCAAGAGTGTTTCTTCTTTATTTTGTACCGCTTCTTTTGTCATTTTTCCATGGGAGTGTGAAGCACCTCCAACCCTACGTCAGGTGTTATGGGGCCCACATCAGATAATGCACGGA---GATGGTCAATTTGAAATTGCTATCAAGACTCGTCTTCATTCAGCTGCTACA---ACTGAAGAAGGGTTTGGTAGACTTGGCATACTCCCG------------------CTCTCCGGGCCTATAGCTCCTGATGCACATGTTGGGTCATACGAGTTTATTGTACATATAAATACTTGGCGGCCCGAC---TCT
TRN  10010101110011000
NAM  Q88483_9COMO/1003-1166
ASQ  NPLTYPIKP-GHLEDLDLVLKSGSIAIGTYTMTKVPVSLAMRVDSAAKRQAYSYAAGVLSHFLGVGGDIIFSVHSTASTFVSCSLRVA-LW-GTIPTTEELAQIPHVDVTL-DAKATLQIQSPFFATAN-FGDDGTAFYIAT------LCAPLAPETMETGFQYYIHIHGINAK-A
DSQ  AATCCACTGACATATCCCATAAAGCCG---GGGCACCTAGAAGATTTGGATCTTGTTCTCAAGTCCGGCAGTATTGCTATAGGCACTTACACTATGACTAAGGTGCCTGTTTCTCTTGCCATGCGTGTGGATTCAGCTGCAAAACGCCAGGCATATTCTTATGCAGCTGGAGTACTGTCCCATTTCTTGGGAGTTGGTGGTGATATTATATTTAGTGTACACAGCACTGCAAGTACTTTTGTTTCTTGCAGCTTACGTGTTGCA---CTCTGG---GGTACAATCCCAACCACCGAAGAACTGGCACAGATACCACATGTGGACGTCACCCTT---GACGCAAAGGCAACTTTGCAGATTCAGTCTCCTTTCTTTGCCACGGCAAAT---TTTGGCGACGACGGGACGGCATTTTACATTGCTACT------------------CTATGCGCACCTCTGGCACCAGAGACCATGGAAACTGGATTCCAATACTACATACACATCCATGGTATCAATGCCAAA---GCC
TRN  10010101100011000
NAM  POL2_BRSV/1007-1170
ASQ  QPLSYPIEA-RHLTDLNLMLAPKQIAVGTYAMITFPVSLAAKLQSTSGRTAYSYAAGLLSHFLGVGGTIHFVVRTTSSAFVTSKLRIA-LW-GTVPETDQLAQMPHVDVEV-NVDASLQIQSPFFSTAN-FGNSGSAFYVST------LCAPMAPETVETGSEYYIQIKGIEAN-P
DSQ  CAGCCCTTGTCATATCCTATTGAGGCT---AGGCATCTTACAGATCTAAATCTGATGCTGGCCCCAAAACAAATTGCTGTTGGGACTTATGCAATGATAACATTTCCAGTATCCCTAGCAGCAAAACTGCAATCAACTTCTGGTAGAACCGCTTATTCTTATGCGGCTGGTTTGTTGTCCCATTTTTTGGGAGTGGGCGGTACAATTCATTTTGTGGTGCGTACTACTTCTAGTGCTTTTGTTACTAGTAAGTTGCGTATTGCT---CTATGG---GGTACAGTACCCGAGACAGATCAGCTTGCACAGATGCCGCATGTTGATGTAGAAGTG---AATGTTGATGCAAGCCTGCAGATACAATCTCCCTTCTTCTCAACTGCTAAT---TTTGGAAATAGCGGATCGGCCTTTTATGTGTCGACT------------------CTATGTGCACCCATGGCACCAGAGACAGTAGAAACCGGATCTGAGTATTACATTCAGATCAAAGGTATTGAGGCGAAT---CCT
TRN  10010101100011001
NAM  POL2_GCMV/981-1144
ASQ  SIVTYPISL-EHLKDIEIMLPPRQMAIGNAGSINFPLSFAVQQKSSSGRIAYSYAAGLLSHFLGIGGTIHFKIQCTSSAFVTARLRVA-LW-GDTITLEQLSQMPHVDCDV-DVVSSLKIQSPFYATAN-FGDSGARFWVTP------MSSPMAPETMESKLEYYIQILGIDAD-P
DSQ  AGTATTGTGACATACCCTATTAGTCTA---GAACATTTGAAAGACATTGAGATAATGCTTCCCCCTCGCCAAATGGCAATTGGGAATGCTGGCTCAATAAATTTTCCACTGTCTTTCGCGGTGCAGCAGAAATCCAGCAGTGGCCGAATTGCATACTCTTATGCTGCTGGTCTTTTGTCACATTTCCTGGGGATAGGGGGTACAATACATTTTAAAATACAATGTACCTCCAGTGCCTTTGTTACGGCACGTCTCCGGGTTGCG---TTATGG---GGGGATACCATAACATTAGAACAGTTGTCCCAGATGCCACACGTTGACTGTGATGTT---GACGTTGTATCATCTCTAAAGATACAATCCCCTTTTTATGCAACTGCAAAT---TTTGGGGATAGTGGGGCACGATTTTGGGTAACCCCT------------------ATGAGCTCTCCCATGGCACCTGAGACCATGGAATCCAAATTGGAGTATTATATCCAAATTTTGGGTATCGATGCTGAT---CCG
TRN  10010101100011000
NAM  Q65029_ARMV/745-916
ASQ  PNFIYSADA-FNGSLKFLTIPPLEYDLSATSAYKSVSLLLGQTLVDGTHKVYNFNNTLLSYYLGIGGIVKGKVHVCSPCTYGIVLRVVSEWNGVTNNWNQLFKYPGCYIEE-DGSFAIEIRSPYHRTPLRLIDAQSASSFTSTLNFYAISGPIAPSGETAKMPVVVQIEEIAL--P
DSQ  CCCAACTTCATTTATAGCGCTGACGCT---TTTAATGGGTCTCTCAAGTTTCTGACTATCCCACCACTGGAATATGACTTAAGTGCAACCAGTGCCTACAAGAGTGTGTCCCTGTTATTGGGGCAGACTCTTGTTGACGGTACTCATAAGGTGTATAATTTTAATAATACACTCTTGAGTTACTATTTAGGCATTGGGGGTATTGTCAAGGGAAAGGTGCATGTTTGTAGCCCTTGCACTTATGGCATAGTCCTAAGAGTTGTTAGTGAATGGAACGGGGTCACTAACAACTGGAATCAACTGTTTAAATACCCCGGGTGTTACATCGAGGAG---GATGGGAGCTTTGCTATTGAAATACGCTCCCCCTACCACCGAACTCCACTTCGCTTAATTGACGCGCAATCAGCAAGCTCTTTTACGAGTACGTTGAATTTTTACGCAATCTCAGGGCCCATAGCCCCAAGTGGAGAAACAGCGAAGATGCCAGTAGTCGTGCAAATTGAAGAAATCGCACTT------CCG
TRN  10010101100011000
NAM  POL2_ARMVS/792-963
ASQ  PNFIYSADA-FNGSLKFLTIPPLEYDLSATSAYKSVSLLLGQTLVDGTHKVYNFNNTLLSYYLGIGGIVKGKVHVCSPCTYGIVLRVVSEWNGVTNNWNQLFKYPGCYIEE-DGSFAIEIRSPYHRTPLRLIDAQSASSFTSTLNFYAISGPIAPSGETAKMPVVVQIEEIAL--P
DSQ  CCCAACTTCATTTATAGCGCTGACGCT---TTTAATGGGTCTCTCAAGTTTCTGACTATCCCACCACTGGAATATGACTTAAGTGCAACCAGTGCCTACAAGAGTGTGTCCCTGTTATTGGGGCAGACTCTTGTTGACGGTACTCATAAGGTGTATAATTTTAATAATACACTCTTGAGTTACTATTTAGGCATTGGGGGTATTGTCAAGGGAAAGGTGCATGTTTGTAGCCCTTGCACTTATGGCATAGTCCTAAGAGTTGTTAGTGAATGGAACGGGGTCACTAACAACTGGAATCAACTGTTTAAATACCCCGGGTGTTACATCGAGGAG---GATGGGAGCTTTGCTATTGAAATACGCTCCCCCTACCACCGAACTCCACTTCGCTTAATTGACGCGCAATCAGCAAGCTCTTTTACGAGTACGTTGAATTTTTACGCAATCTCAGGGCCCATAGCCCCAAGTGGAGAAACAGCGAAGATGCCAGTAGTCGTGCAAATTGAAGAAATCGCACTT------CCG
TRN  10010101100011000
NAM  Q67703_GFLV/166-336
ASQ  PTLVFDPGV-FNGKFQFLTCPPIFFDLTAVTALKSAGLTLGQVPMVGTTRVYNLNSTLVSCVLGMGGTIRGKVHICAPIFYSIVLWVVSEWNGTTMDWNELFKYPGVYVEE-DGSSEVKIRSPYHRTPARLLAGQSQRDMSS-LNFYAIAGPIAPSGETARLPIVVQIEEIVR--P
DSQ  CCAACTTTGGTTTTTGACCCAGGTGTT---TTTAATGGTAAATTCCAATTTCTCACTTGCCCTCCCATATTCTTCGATTTGACGGCCGTCACGGCTCTTAAGAGTGCTGGGCTGACATTGGGACAAGTCCCAATGGTTGGCACTACTAGGGTTTATAATCTAAATAGCACTCTCGTAAGCTGTGTTTTGGGTATGGGAGGTACTATTAGAGGAAAGGTGCACATTTGTGCTCCAATCTTCTATAGTATTGTTTTGTGGGTCGTTAGTGAGTGGAACGGGACCACTATGGATTGGAATGAACTTTTTAAGTATCCCGGGGTGTATGTGGAAGAG---GACGGAAGTTCTGAAGTCAAAATTCGCTCTCCATATCACCGAACGCCTGCTAGATTGCTTGCTGGTCAAAGTCAGAGGGACATGAGCTCT---CTAAATTTTTACGCAATAGCAGGGCCTATCGCTCCATCGGGTGAGACTGCGCGACTTCCTATCGTTGTGCAGATTGAAGAAATTGTGCGC------CCG
TRN  10010101100011011
NAM  POL2_GFLV/771-941
ASQ  PTLVFDPGV-FNGKFQFLTCPPIFFDLTAVTALRSAGLTLGQVPMVGTTKVYNLNSTLVSCVLGMGGTVRGRVHICAPIFYSIVLWVVSEWNGTTMDWNELFKYPGVYVEE-DGSFEVKIRSPYHRTPARLLAGQSQRDMSS-LNFYAIAGPIAPSGETAQLPIVVQIDEIVR--P
DSQ  CCAACTTTGGTTTTTGACCCAGGTGTT---TTCAATGGCAAATTTCAATTTCTTACTTGCCCTCCCATATTCTTTGATTTAACGGCCGTCACGGCCCTTAGGAGTGCTGGGCTGACATTGGGGCAAGTCCCAATGGTTGGCACCACTAAGGTTTATAATCTAAACAGCACTCTTGTGAGTTGTGTTTTGGGTATGGGAGGTACTGTTAGAGGGAGGGTGCACATTTGTGCGCCAATCTTCTACAGTATTGTTTTATGGGTCGTTAGTGAGTGGAACGGGACCACTATGGACTGGAATGAACTTTTTAAGTATCCCGGGGTGTATGTGGAAGAG---GACGGAAGTTTTGAAGTAAAGATTCGCTCTCCATATCACCGAACTCCTGCCAGATTGCTTGCTGGTCAAAGTCAGAGAGACATGAGCTCT---CTTAATTTTTATGCAATAGCAGGACCTATCGCTCCTTCGGGTGAGACTGCGCAACTTCCTATTGTTGTGCAGATAGATGAAATTGTGCGC------CCA
TRN  10010101100011010
//