EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03382 - DUF285)
FAM  PF03382
PID  DUF285
DES  Mycoplasma protein of unknown function, DUF285
IPR  IPR005046
ANO  5
ALN  161
AID  0.698298
APH  ((Q9RG02_MYCCA/71-229:0.13448,Q9RG11_MYCML/73-230:0.11857):0.13309,(Q9RFZ9_MYCCA/75-233:0.29720,Q9RFZ0_MYCMS/74-233:0.20939):0.13118,Q9RAJ0_9MOLU/71-230:0.20670);
ATP  ((Q9RG02_MYCCA/71-229,Q9RG11_MYCML/73-230),(Q9RFZ9_MYCCA/75-233,Q9RFZ0_MYCMS/74-233),Q9RAJ0_9MOLU/71-230);
ATL  1.23061
DNO  5
DLN  483
DID  0.724693
DPH  (Q9RG11_MYCML/73-230:9.81628,Q9RG02_MYCCA/71-229:8.58298,((Q9RFZ0_MYCMS/74-233:14.54704,Q9RFZ9_MYCCA/75-233:15.51607):5.66136,Q9RAJ0_9MOLU/71-230:8.14121):9.19838);
DTP  (Q9RG11_MYCML/73-230,Q9RG02_MYCCA/71-229,((Q9RFZ0_MYCMS/74-233,Q9RFZ9_MYCCA/75-233),Q9RAJ0_9MOLU/71-230));
DTL  71.4626
RID  0.698298
RPH  ((Q9RG02_MYCCA/71-229:0.13448,Q9RG11_MYCML/73-230:0.11857):0.13309,(Q9RFZ9_MYCCA/75-233:0.29720,Q9RFZ0_MYCMS/74-233:0.20939):0.13118,Q9RAJ0_9MOLU/71-230:0.20670);
RTP  ((Q9RG02_MYCCA/71-229,Q9RG11_MYCML/73-230),(Q9RFZ9_MYCCA/75-233,Q9RFZ0_MYCMS/74-233),Q9RAJ0_9MOLU/71-230);
RTL  1.23061
LNK  Q9RAJ0_9MOLU/71-230:Q9RAJ0:AF162989
LNK  Q9RFZ0_MYCMS/74-233:Q9RFZ0:AF162999
LNK  Q9RFZ9_MYCCA/75-233:Q9RFZ9:AF162995
LNK  Q9RG02_MYCCA/71-229:Q9RG02:AF162994
LNK  Q9RG11_MYCML/73-230:Q9RG11:AF162988
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9RG11_MYCML/73-230
ASQ  KGIPKTVKKVSSKLPEKITSLYGAFSYRNPN-D-TDVTGFEKWDTKNITDMSYVFSNNSIVNADLSSWDTSKVTNMNGMFKNAAKFNNGGKPLNWKTYNVEMMEEMFDGATSFDQDLKDWKVDKVKKNKNFSRGSGIFGFENKRPKWT-LTEINDPIEKKI
DSQ  AAAGGAATTCCAAAAACAGTTAAAAAAGTTTCTTCTAAATTACCTGAAAAAATTACAAGTCTTTATGGAGCCTTTTCATATCGAAATCCAAAT---GAT---ACAGATGTAACTGGTTTTGAAAAATGAGATACTAAAAACATAACAGATATGAGCTATGTTTTTTCTAATAATTCTATTGTTAATGCTGATTTATCATCATGAGATACTTCAAAAGTAACTAATATGAATGGTATGTTTAAAAATGCAGCAAAGTTTAACAATGGTGGTAAACCATTAAATTGAAAAACCTATAATGTTGAGATGATGGAAGAAATGTTTGACGGTGCTACTTCTTTTGATCAAGATTTAAAGGATTGAAAAGTTGACAAAGTTAAAAAGAATAAAAACTTTTCAAGAGGAAGTGGTATTTTTGGTTTTGAGAATAAAAGACCTAAATGAACT---TTAACTGAAATAAATGATCCAATAGAAAAGAAAATA
TRN  00010000000000000
NAM  Q9RG02_MYCCA/71-229
ASQ  KGIPKTVKKVSSSLPPEITSLYGAFSYRNTD-D-VIVTGFERWDTKNITDMSYVFSNNSIVDIDLSFWDTSKVTNMNGMFKNAVKFNNGGKPLKWTTSNVETMESMFDGATNFDQNLKDWKVDRVKNNKNFSRGSIFSNYENKKPKWKGVIEINDPIIKKP
DSQ  AAAGGAATACCAAAAACAGTTAAAAAAGTTTCTAGTTCTTTACCACCTGAGATTACAAGTCTTTATGGAGCTTTTTCCTATAGGAATACAGAT---GAT---GTAATTGTAACCGGATTTGAAAGATGAGATACAAAGAACATTACTGATATGAGTTATGTTTTTTCAAATAATTCAATTGTTGATATTGATTTATCATTTTGGGATACTTCTAAAGTAACCAATATGAATGGTATGTTTAAAAATGCTGTTAAATTCAATAATGGTGGTAAACCATTAAAATGAACTACTAGCAATGTAGAAACTATGGAATCTATGTTTGATGGAGCGACAAATTTTGATCAAAATTTAAAAGATTGAAAAGTGGATAGAGTTAAAAATAATAAAAATTTCTCAAGAGGAAGTATTTTTTCTAATTATGAAAATAAAAAACCTAAATGAAAAGGTGTAATAGAAATTAACGACCCAATTATTAAAAAACCA
TRN  00010000000000000
NAM  Q9RAJ0_9MOLU/71-230
ASQ  KQIPPKIKKVSGQLPTEIKSLYGAFSNRNIN-NGVKVTGFETWDTSNITDMSYVFSNNHIFDADISKWKTNNVTNMNGMFKNATQFNNGGKSLEWDTSNVTSMDSMFEGATNFSQSLKNWRVEKVTKNKNFSRGSGIFGYSNKKPNWNSITEINDPIEKKV
DSQ  AAGCAAATACCACCAAAAATTAAGAAGGTTTCAGGACAATTACCTACTGAAATTAAAAGTTTATATGGAGCCTTTTCAAATAGAAATATTAAT---AATGGTGTAAAAGTCACAGGTTTTGAAACATGAGATACTTCAAATATAACTGATATGAGCTATGTTTTTTCTAATAATCATATTTTTGATGCAGATATATCAAAGTGAAAGACTAATAATGTGACAAATATGAATGGAATGTTCAAAAATGCAACACAATTTAATAATGGCGGAAAATCACTAGAATGAGATACTAGTAATGTTACATCAATGGACTCTATGTTTGAAGGCGCCACTAATTTTAGCCAAAGTTTGAAAAATTGGAGAGTTGAAAAGGTTACTAAGAATAAAAATTTTTCTAGAGGAAGTGGTATTTTTGGCTATAGCAATAAAAAACCTAATTGAAATAGCATAACAGAAATTAATGATCCAATAGAAAAGAAAGTT
TRN  00010000000000000
NAM  Q9RFZ9_MYCCA/75-233
ASQ  RQIPQNVKKVPNELPVEIESLFGAFANRF--EHHENVMGFENWNTSKIKDMSYVFSNNHIFNGDLSNWNTENVENMQGMFKNAIKFDNSGKPLSWRTDKVTSMESMFDGAKSFGQNLMNWKVDKVIKNRNFSRGSGFFEENNKKPKWINIKEENDPIDKPK
DSQ  AGACAAATACCACAAAACGTTAAAAAAGTACCAAATGAATTACCCGTAGAAATTGAAAGTCTATTTGGTGCATTTGCTAATAGATTT------GAACACCATGAAAATGTAATGGGATTTGAAAATTGAAACACATCTAAAATAAAGGATATGAGTTATGTTTTTTCTAATAACCATATTTTTAATGGTGATTTATCAAACTGAAATACTGAAAATGTTGAAAATATGCAAGGTATGTTTAAAAATGCTATTAAATTTGATAATTCTGGAAAACCTTTGAGTTGAAGAACTGATAAAGTCACTTCAATGGAATCTATGTTTGATGGAGCTAAGAGTTTTGGTCAAAATTTAATGAATTGAAAAGTTGATAAAGTCATTAAAAATAGAAATTTTTCGAGAGGTAGCGGTTTTTTTGAAGAAAATAATAAAAAGCCAAAATGAATAAATATAAAAGAAGAAAATGATCCAATTGATAAACCAAAA
TRN  00010000000000000
NAM  Q9RFZ0_MYCMS/74-233
ASQ  KQIPYYVKKVPDKLPDEIQSLYRAFAHRYKDQNHPTVTGFEKWDTSKIKNMSYVFYDNQLIDADLSEWKTSNVTNMDGMFKNAIKFNNKEKPLKWNTEKVESMESMFDGAESFKQNLKDWKVDKVTKNKNFSRASGIFEHIDKKPSWK-ITEHNDPIIKKP
DSQ  AAACAAATTCCATATTACGTTAAAAAAGTTCCTGATAAGCTTCCTGATGAAATTCAAAGTTTATATCGAGCCTTTGCTCATAGATATAAAGATCAAAACCACCCTACAGTTACTGGATTTGAAAAATGAGATACATCAAAAATAAAGAATATGAGTTATGTATTTTATGATAATCAATTGATAGATGCAGATTTATCAGAATGAAAAACAAGCAATGTTACTAATATGGATGGAATGTTTAAAAATGCTATTAAATTCAATAATAAAGAGAAACCTTTAAAATGAAACACTGAAAAAGTTGAATCAATGGAATCTATGTTTGATGGTGCAGAAAGCTTTAAACAAAATTTAAAAGATTGAAAAGTTGATAAGGTAACTAAAAATAAGAATTTTTCTAGAGCTAGTGGGATTTTTGAACACATCGATAAAAAACCTAGTTGAAAA---ATTACTGAGCATAACGACCCTATTATTAAAAAACCA
TRN  00010000000000000
//