EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF03301 - Trp_dioxygenase)
FAM  PF03301
PID  Trp_dioxygenase
DES  Tryptophan 2,3-dioxygenase
IPR  IPR004981
ANO  5
ALN  354
AID  0.376401
APH  (T23O_RAT/26-372:0.33468,(T23O_CAEEL/22-371:0.29139,(Q9RYH4_DEIRA/16-287:0.29025,Q9X8R3_STRCO/1-271:0.91953):1.01948):0.11988,O77457_ANOGA/11-358:0.32025);
ATP  (T23O_RAT/26-372,(T23O_CAEEL/22-371,(Q9RYH4_DEIRA/16-287,Q9X8R3_STRCO/1-271)),O77457_ANOGA/11-358);
ATL  3.29546
DNO  4
DLN  1062
DID  0.470678
DPH  (T23O_RAT/26-372:0.45706,(Q9RYH4_DEIRA/16-287:0.34734,Q9X8R3_STRCO/1-271:0.37685):0.46419,O77457_ANOGA/11-358:0.16489);
DTP  (T23O_RAT/26-372,(Q9RYH4_DEIRA/16-287,Q9X8R3_STRCO/1-271),O77457_ANOGA/11-358);
DTL  1.81033
RID  0.349167
RPH  (T23O_RAT/26-372:0.33866,(Q9RYH4_DEIRA/16-287:0.35329,Q9X8R3_STRCO/1-271:0.84746):0.99504,O77457_ANOGA/11-358:0.27681);
RTP  (T23O_RAT/26-372,(Q9RYH4_DEIRA/16-287,Q9X8R3_STRCO/1-271),O77457_ANOGA/11-358);
RTL  2.81126
LNK  O77457_ANOGA/11-358:O77457:L76433
LNK  Q9RYH4_DEIRA/16-287:Q9RYH4:AE001863
LNK  Q9X8R3_STRCO/1-271:Q9X8R3:AL939117
LNK  T23O_CAEEL/22-371:Q09474:
LNK  T23O_RAT/26-372:P21643:M55167
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx......xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  O77457_ANOGA/11-358
ASQ  DSVQGGHHLGSEA-GMLYGEYLMLDKVLSAQRMLSVEGKKPVHDEHLFIVTHQAYELWFKQIIFELDSIRDLFSTEHIEESR-TLEILKRLNRIVMILKLLVDQVPILETMTPLDFMDFRDYLSPASGFQSLQFRLLENKLGVKSEHRVKYNQK-YTEVFASDPGAIERIGTTETEPSLADLVQKWLERTPGLEQDGFN..FWGKFQESVEQLLAEQEASAMSEEHENVREYRL-MDIDKRREVYKSIFDAQVHDALVARGERRFTHKALQGAIMITFYRDEPRFSQPHQLLMLLMDIDSLITKWRYNHVIMVQRMIGSQQLGTGGSSGYQYLRSTLSDRYKVFLDLFNLSTFL
DSQ  GATTCGGTGCAGGGTGGACACCATCTCGGGTCGGAGGCG---GGCATGCTGTACGGCGAGTACCTGATGCTGGACAAGGTGCTCAGTGCGCAGCGCATGCTGTCCGTCGAGGGCAAGAAGCCGGTGCACGACGAGCATCTGTTCATCGTGACGCATCAGGCGTACGAGCTGTGGTTCAAGCAGATCATCTTCGAGCTGGATTCGATTCGCGATCTCTTCAGCACCGAGCACATCGAGGAGTCGCGT---ACGCTCGAGATTCTGAAGCGTCTCAATCGGATTGTGATGATTCTGAAGCTGCTGGTGGATCAGGTCCCGATCCTCGAAACGATGACACCGCTCGACTTTATGGACTTTCGCGACTACCTGTCGCCGGCGTCCGGCTTCCAGAGCCTGCAGTTCCGGCTGCTGGAGAACAAGCTCGGCGTAAAGTCGGAACACCGCGTCAAGTACAATCAAAAG---TACACGGAAGTGTTTGCCAGCGATCCGGGCGCGATCGAGCGGATCGGTACCACCGAGACGGAACCGTCGCTGGCCGATCTGGTGCAGAAGTGGCTGGAGCGTACGCCCGGGCTGGAGCAGGATGGGTTTAAC......TTCTGGGGCAAGTTTCAGGAGAGCGTCGAGCAGCTGCTGGCCGAGCAGGAAGCGAGCGCAATGTCGGAAGAGCATGAGAACGTGCGCGAGTATCGGCTG---ATGGACATTGACAAGCGGCGCGAGGTGTACAAGTCCATCTTTGACGCGCAGGTGCACGATGCGCTGGTGGCGCGCGGTGAGCGTCGCTTCACGCATAAGGCGCTGCAGGGTGCGATCATGATAACGTTCTATCGCGACGAGCCACGGTTTAGCCAGCCGCACCAGCTGCTAATGCTGCTGATGGACATCGATTCGCTGATCACCAAGTGGCGATATAACCACGTCATTATGGTGCAGCGTATGATTGGCTCGCAGCAGCTTGGCACCGGTGGCTCTTCCGGATATCAGTACTTACGTTCAACCTTAAGCGATCGGTATAAAGTGTTTCTCGATCTGTTCAACCTGTCCACGTTCCTG
TRN  10010101100011000
NAM  T23O_RAT/26-372
ASQ  DGAQTGVNRASKG-GLIYGDYLQLEKILNAQELQSEIKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVMTRMHRVVVIFKLLVQQFSVLETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQSLRVPYNRKHYRDNFEGDYN--ELLLKSEQEQTLLQLVEAWLERTPGLEPHGFN..FWGKFEKNILKGLEEEFLKIQAKKDSEEKEEQM-AEFRKQKEVLLCLFDEKRHDYLLSKGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDTLMTKWRYNHVCMVHRMLGS-KAGTGGSSGYYYLRSTVSDRYKVFVDLFNLSSYL
DSQ  GACGGAGCTCAAACTGGTGTAAACAGAGCCAGCAAAGGA---GGACTTATCTATGGGGACTACTTGCAGTTGGAGAAGATTTTGAATGCACAAGAACTTCAAAGTGAAATCAAAGGGAATAAAATCCACGACGAGCACCTCTTTATTATAACTCACCAAGCTTATGAACTTTGGTTTAAACAAATTCTCTGGGAACTTGATTCTGTTCGTGAGATTTTTCAAAATGGCCATGTCAGGGATGAGAGGAACATGCTCAAGGTGATGACTCGGATGCACCGTGTGGTGGTCATCTTCAAGCTCCTGGTACAGCAGTTCTCGGTTCTGGAAACAATGACTGCCTTGGACTTCAATGACTTCAGAGAGTACCTGTCTCCAGCATCAGGCTTCCAGAGTCTTCAGTTCCGGCTGCTAGAAAATAAGATAGGTGTTCTTCAGAGCTTGAGAGTCCCTTACAACAGGAAACACTATCGTGATAACTTTGAAGGAGACTACAAT------GAGCTGCTGCTGAAATCGGAGCAGGAGCAGACGCTATTGCAGCTGGTGGAGGCATGGCTGGAACGCACACCTGGCTTAGAGCCACATGGATTCAAT......TTCTGGGGAAAGTTTGAAAAAAATATCTTGAAGGGTCTGGAAGAGGAGTTCCTAAAGATTCAGGCGAAAAAGGACTCTGAAGAAAAAGAGGAACAGATG---GCAGAGTTCCGGAAGCAGAAAGAGGTGCTGCTCTGCTTGTTCGATGAGAAGCGTCATGACTACCTTCTGAGTAAAGGTGAACGACGACTGTCATACCGTGCACTCCAGGGAGCACTGATGATATATTTTTACAGGGAGGAGCCTCGATTCCAGGTCCCTTTCCAGTTGCTGACCTCACTTATGGACATTGACACACTCATGACCAAATGGAGATATAATCATGTGTGCATGGTGCACAGGATGCTAGGCAGC---AAGGCTGGCACTGGGGGATCCTCAGGCTATTATTATCTGCGCTCAACTGTGAGCGACAGGTACAAGGTGTTCGTGGATTTATTTAACCTCTCATCGTACCTG
TRN  10010101100011000
NAM  T23O_CAEEL/22-371
ASQ  EECQQGVNKVEMGFGQTYSEYLQLDKILTAQRLKSEADGQRVDDEHLFIVIHQAHELWFKQIIFDLDNVRKLLNNTIVDETK-TLKIVSGLDRMTKILSLLTEQITLLDTMSPLDFVDFRKYLTPASGFQSLQFRVLENKLGVRQERRIKYNAQHYKNVFNDTDL--KTLNVTEEEKSLLTLIESWLERTPGLKSTSEDegFWIKYEKSVNKYLADLAKQAADPSNTEEIAKQLTAEYHKTADAFQSILDPRQHEQHIRNGNRLLSHDATKGAMMIYFYRDMPRFSQPYQILTFLMDIDSLFTKWRYNHVLLVQRMLGA-KQGTGGSSGYMYLRSTVSDRYKVFLDLFNLSTWL
NAM  Q9RYH4_DEIRA/16-287
ASQ  HSAEQAHRDFSRS--LSYGDYLHLDELRSAHQPITD-----AHDEHLFIAIHHVSEVWLSLIVRELQAAMRLLDAGITDAPL------KMLTRVVRAQEQLTAAWDVLKTMTPADYLQFRGAFGQASGFQSQNYRMVEFLLGNRNS-----------T-----------LLRPHEHRADLHRPLAAALHAP--------..-------SVYDLTLRLLAARGLPVPAEVLQRDYAQPYQTNEAVLASWLS---------------------------VYCDTETYWDLYELAEKLVDVEDNFRRWRFNHLTTVERTIGF-KRGSGGTSGVGYLRG--ALDVVLFPELWDVRTQL
DSQ  CACTCCGCCGAGCAGGCGCACCGCGATTTCAGCCGCTCG------CTGAGCTACGGCGACTACCTGCACCTCGACGAGCTGCGCTCGGCGCACCAGCCGATCACCGAC---------------GCCCACGACGAGCATCTGTTTATCGCCATTCACCATGTGTCCGAGGTGTGGCTCTCGCTCATCGTGCGCGAGTTGCAGGCGGCGATGAGACTGCTCGACGCCGGCATCACCGACGCGCCGCTG------------------AAGATGCTGACCCGCGTGGTCCGCGCTCAGGAACAGCTCACCGCCGCCTGGGACGTGCTCAAGACGATGACGCCCGCCGACTACCTCCAGTTTCGCGGCGCCTTTGGGCAAGCGTCGGGGTTTCAGTCGCAAAACTACCGCATGGTCGAATTCCTGCTCGGCAACCGCAACTCC---------------------------------ACG---------------------------------CTGCTGCGCCCGCACGAGCACCGCGCCGACCTGCACCGCCCCCTCGCCGCCGCGCTGCACGCCCCC------------------------......---------------------AGCGTGTACGACCTCACCCTGCGCCTCCTCGCCGCGCGGGGGCTGCCGGTGCCCGCCGAGGTGCTGCAACGCGACTACGCCCAGCCTTACCAAACGAACGAAGCGGTCCTGGCAAGCTGGCTGAGC---------------------------------------------------------------------------------GTGTACTGCGACACCGAGACTTACTGGGACCTCTACGAACTCGCCGAGAAGCTGGTGGATGTGGAGGACAACTTCCGGCGCTGGCGTTTCAACCACCTCACCACCGTGGAACGCACCATCGGCTTC---AAGCGCGGCTCGGGCGGCACCAGCGGCGTGGGCTACCTGCGCGGG------GCCCTTGACGTGGTGCTGTTTCCCGAACTGTGGGACGTGAGGACGCAATTG
TRN  10010101100011011
NAM  Q9X8R3_STRCO/1-271
ASQ  MSHDAPNLDFEGS--TPYEDYVKADVLTHLQHTLSD-----DPGEMVFLVTTQVMELWFTVIVHEWETAARALREDRTPVAT------DALKRSVRELEALNASWTPLAGLTPAQFNSYRSALGEGSGFQSAMYRRLEFLLGDKSAS----------------------MLVPHRGAPRVHAELEKALHEP--------..-------SLYDEVVRLLARRGYDIPDAVLQRDLTRKYEAAPEVEAAWTA---------------------------VYSGDQNG-ELARLGEALTDVAELVWRWRNDHLVATRRAMGS-KTGTGGSAGVAWLEK--RARNNVFPELWTARSYV
DSQ  ATGTCCCACGACGCCCCGAATCTCGACTTCGAGGGCAGC------ACGCCGTACGAGGACTACGTCAAGGCGGACGTGCTCACCCACCTCCAGCACACCCTCTCGGAC---------------GATCCCGGAGAGATGGTCTTCCTGGTCACGACCCAGGTCATGGAGCTGTGGTTCACCGTCATCGTCCACGAATGGGAGACCGCCGCCCGCGCCCTGCGCGAGGACCGGACCCCGGTGGCGACC------------------GACGCGCTCAAGCGTTCGGTGCGGGAGCTGGAGGCGCTGAACGCCTCCTGGACGCCGCTCGCGGGCCTCACGCCCGCCCAGTTCAACTCCTACCGGTCCGCCCTCGGCGAGGGCTCCGGCTTCCAGTCGGCGATGTACCGCCGCCTGGAGTTCCTGCTCGGCGACAAGTCCGCGTCC------------------------------------------------------------------ATGCTCGTCCCGCACCGCGGCGCCCCGCGCGTCCACGCGGAGCTGGAGAAGGCGCTGCACGAGCCG------------------------......---------------------AGCCTGTACGACGAGGTGGTCCGGCTGCTCGCCCGGCGCGGGTACGACATCCCGGACGCCGTGCTCCAGCGCGACCTCACCCGGAAGTACGAGGCCGCCCCCGAGGTCGAGGCCGCCTGGACGGCC---------------------------------------------------------------------------------GTCTACTCCGGCGACCAGAACGGC---GAGCTGGCCCGCCTCGGCGAGGCCCTCACCGACGTCGCCGAGCTGGTGTGGCGCTGGCGCAACGACCACCTGGTCGCCACCCGCCGCGCGATGGGCTCC---AAGACCGGCACGGGCGGCTCCGCCGGGGTGGCCTGGCTGGAGAAG------CGGGCCCGCAACAACGTGTTCCCCGAGCTGTGGACGGCGCGGTCGTATGTC
TRN  11011111101111111
//